Hydrophobin-2/HFB2 Protein, Trichoderma reesei (P.pastoris)

Hydrophobin-2/HFB2 protein critically imparts spores with hydrophobicity, enhancing their resilience and protective functions. This hydrophobic character, crucial for spore survival, improves resistance to moisture and shields against environmental threats. The significance of Hydrophobin-2/HFB2 in biological strategies is underscored by its role in ensuring the durability and viability of spores in various ecological conditions. Hydrophobin-2/HFB2 Protein, Trichoderma reesei (P.pastoris) is the recombinant Hydrophobin-2/HFB2 protein, expressed by P. pastoris , with tag free.

Hydrophobin-2/HFB2 protein plays a critical role in conferring spore hydrophobicity and providing protective functions. This protein is responsible for imparting a hydrophobic character to spores, a feature essential for their survival and resilience in various environmental conditions. By contributing to spore hydrophobicity, Hydrophobin-2/HFB2 not only enhances the spores' resistance to moisture but also safeguards them from potential threats. The protective function of this protein underscores its significance in the biological strategies employed by organisms, ensuring the durability and viability of spores in diverse ecological settings.

Others

P. pastoris

Tag Free

P79073 (A16-F86)

18482765  [NCBI]

AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Approximately 23.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.