1. Recombinant Proteins
  2. Enzymes & Regulators
  3. IFI27L2A Protein, Mouse (Cell-Free, His)

The IFI27L2A protein critically regulates interferon-induced transcriptional activity, specifically NR4A1, NR4A2, and NR4A3. Its interaction with XPO1 enhances the nuclear export of these receptors, with potential vascular effects on the injury response. IFI27L2A Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived IFI27L2A protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of IFI27L2A Protein, Mouse (Cell-Free, His) is 66 a.a., with molecular weight of 7.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IFI27L2A protein critically regulates interferon-induced transcriptional activity, specifically NR4A1, NR4A2, and NR4A3. Its interaction with XPO1 enhances the nuclear export of these receptors, with potential vascular effects on the injury response. IFI27L2A Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived IFI27L2A protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of IFI27L2A Protein, Mouse (Cell-Free, His) is 66 a.a., with molecular weight of 7.3 kDa.

Background

IFI27L2A Protein appears to play a crucial role in the interferon-induced negative regulation of transcriptional activity associated with NR4A1, NR4A2, and NR4A3, achieved by enhancing the XPO1-mediated nuclear export of these nuclear receptors. This interaction suggests a potential involvement in mediating cellular responses, particularly in the vascular context where the regulation of NR4A1 transcriptional activity may contribute to the response to injury. The homodimeric nature of IFI27L2A, along with its interactions with SKP2, NR4A1, and potentially BCL2, further underscores its multifaceted roles in cellular processes, emphasizing its significance in the intricate regulatory networks governing gene expression and cellular responses. Unraveling the detailed mechanisms by which IFI27L2A orchestrates these interactions could provide valuable insights into its functional significance and potential implications in various biological contexts.

Species

Mouse

Source

E. coli Cell-free

Tag

N-10*His

Accession

Q8R412 (A25-L90)

Gene ID

76933

Molecular Construction
N-term
10*His
IFI27L2A (A25-L90)
Accession # Q8R412
C-term
Synonyms
Interferon alpha-inducible protein 27-like protein 2A; Interferon-stimulated gene 12 protein; ISG12
AA Sequence

AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGAAVGALL

Molecular Weight

11 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS,0.05% FOS12, 6% Trehalose,pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFI27L2A Protein, Mouse (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFI27L2A Protein, Mouse (Cell-Free, His)
Cat. No.:
HY-P702333
Quantity:
MCE Japan Authorized Agent: