IFI30 Protein, Human (HEK293, His)

IFI30 is a lysosomal thiol reductase that plays a critical role in reducing protein disulfide bonds in the lysosomal environment. This enzymatic activity is critical for complete unfolding of proteins for lysosomal degradation. IFI30 Protein, Human (HEK293, His) is the recombinant human-derived IFI30 protein, expressed by HEK293 , with C-His labeled tag. The total length of IFI30 Protein, Human (HEK293, His) is 217 a.a., with molecular weight of 31-34 kDa.

IFI30, a lysosomal thiol reductase, serves as a key player in the reduction of protein disulfide bonds within the lysosomal environment. This enzymatic activity is crucial for the complete unfolding of proteins targeted for lysosomal degradation. Notably, IFI30 plays a pivotal role in antigen processing, specifically contributing to the generation of MHC class II-restricted epitopes from antigens containing disulfide bonds through endocytic reduction. Additionally, IFI30 is implicated in facilitating MHC class I-restricted recognition of exogenous antigens with disulfide bonds by CD8+ T-cells, thus contributing to cross-presentation processes.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-His

P13284 (S27-K243)

10437  [NCBI]

SPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSS

31-34 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.