IFN-epsilon Protein, Human (His)

IFN-ε protein is a type I interferon that is critical for maintaining baseline levels of IFN-regulated genes (such as 2'-5'-oligoadenylate synthetase, IRF7, and ISG15) in the female reproductive tract. It acts as a direct mediator, providing protection against viral and bacterial genital infections. IFN-epsilon Protein, Human (His) is the recombinant human-derived IFN-epsilon protein, expressed by E. coli , with N-6*His labeled tag. The total length of IFN-epsilon Protein, Human (His) is 187 a.a., with molecular weight of ~26.1 kDa.

IFN-epsilon Protein, a type I interferon, plays a crucial role in sustaining baseline levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7, and ISG15, within the female reproductive tract. Specifically, it serves as a direct mediator in providing protection against viral and bacterial genital infections. By maintaining the expression of key antiviral and immune regulatory genes, IFN-epsilon contributes to the defense mechanisms that safeguard the female reproductive tract against microbial threats, highlighting its significance in the innate immune response in this anatomical context.

Human

E. coli

N-6*His

Q86WN2 (L22-R208)

338376  [NCBI]

LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR

Approximately 26.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.