IFN-gamma R1/CD119 Protein, Human (HEK293, His, solution)

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma,IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate^[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54)^[2]. IFN-gamma R1/CD119 Protein, Human (HEK293, His, solution) is a recombinant human IFN-gamma R1 (E18-G245) with C-terminal 6*His tag, which is produced in HEK293 cells.

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 is constitutively expressed on the surface of almost all cells^[1].
IFN-gamma R1 can associate with IFN-gamma R2 to form a functional receptor. Upon binding with IFN-gamma, IFNγR1 and IFNγR2 oligomerize and transphosphorylate^[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. The phosphorylation of IFNγR1 creates a docking site for STAT1 and leads to the phosphorylation of STAT1. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). Mutations in the gene IFNGR1 which encodes the IFN-gamma R1 cause a primary immunodeficiency and leads to mycobacterial infection, such as Mendelian susceptibility to mycobacterial disease (MSMD)^[2]
Human IFN-gamma R1 consists of extracellular domain (E18-G245), helical domain (S246-I266), and cytoplasmic domain (C267-S489). The sequence of amino acids in IFNAR1 differs in different species. Human IFN-gamma R1 shares 50% aa sequence identity with mouse. IFN-gamma R1 plays a critical role in antimicrobial, antiviral, and antitumor responses^[2].

Human

HEK293

C-6*His

P15260-1 (E18-G245)

3459  [NCBI]

EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG

40-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Castro F, et al. Interferon-Gamma at the Crossroads of Tumor Immune Surveillance or Evasion. Front Immunol. 2018 May 4;9:847.  [Content Brief]

  [2]. van de Vosse E, et al. IFN-γR1 defects: Mutation update and description of the IFNGR1 variation database. Hum Mutat. 2017 Oct;38(10):1286-1296.  [Content Brief]