1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-gamma Receptor
  5. IFN-gamma R1
  6. IFN-gamma R1/CD119 Protein, Human (HEK293, His, solution)

IFN-gamma R1/CD119 Protein, Human (HEK293, His, solution)

Cat. No.: HY-P72612
SDS COA Handling Instructions Technical Support

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma,IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). IFN-gamma R1/CD119 Protein, Human (HEK293, His, solution) is a recombinant human IFN-gamma R1 (E18-G245) with C-terminal 6*His tag, which is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma,IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54)[2]. IFN-gamma R1/CD119 Protein, Human (HEK293, His, solution) is a recombinant human IFN-gamma R1 (E18-G245) with C-terminal 6*His tag, which is produced in HEK293 cells.

Background

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 is constitutively expressed on the surface of almost all cells[1].
IFN-gamma R1 can associate with IFN-gamma R2 to form a functional receptor. Upon binding with IFN-gamma, IFNγR1 and IFNγR2 oligomerize and transphosphorylate[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. The phosphorylation of IFNγR1 creates a docking site for STAT1 and leads to the phosphorylation of STAT1. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). Mutations in the gene IFNGR1 which encodes the IFN-gamma R1 cause a primary immunodeficiency and leads to mycobacterial infection, such as Mendelian susceptibility to mycobacterial disease (MSMD)[2]
Human IFN-gamma R1 consists of extracellular domain (E18-G245), helical domain (S246-I266), and cytoplasmic domain (C267-S489). The sequence of amino acids in IFNAR1 differs in different species. Human IFN-gamma R1 shares 50% aa sequence identity with mouse. IFN-gamma R1 plays a critical role in antimicrobial, antiviral, and antitumor responses[2].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P15260-1 (E18-G245)

Gene ID
Molecular Construction
N-term
IFNGR1 (E18-G245)
Accession # P15260-1
6*His
C-term
Synonyms
Interferon gamma receptor 1; IFN-gamma-R1; IFN-gamma-R-alpha; CD119; Ifngr1
AA Sequence

EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG

Molecular Weight

40-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

IFN-gamma R1/CD119 Protein, Human (HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma R1/CD119 Protein, Human (HEK293, His, solution)
Cat. No.:
HY-P72612
Quantity:
MCE Japan Authorized Agent: