1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-gamma Receptor
  5. IFN-gamma R1
  6. IFN-gamma R1/CD119 Protein, Mouse (HEK293, His)

IFN-gamma R1/CD119 Protein, Mouse (HEK293, His)

Cat. No.: HY-P72611
Handling Instructions Technical Support

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma, IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). IFN-gamma R1/CD119 Protein, Mouse (HEK293, His) is a recombinant mouse IFN-gamma R1 with C-terminal 6*His tag, which is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma, IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54)[2]. IFN-gamma R1/CD119 Protein, Mouse (HEK293, His) is a recombinant mouse IFN-gamma R1 with C-terminal 6*His tag, which is produced in HEK293 cells.

Background

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 is constitutively expressed on the surface of almost all cells[1].
IFN-gamma R1 can associate with IFN-gamma R2 to form a functional receptor. Upon binding with IFN-gamma, IFNγR1 and IFNγR2 oligomerize and transphosphorylate[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. The phosphorylation of IFNγR1 creates a docking site for STAT1 and leads to the phosphorylation of STAT1. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). IFN-gamma R1 deficiencies are associated with immune responses mediated by IFN-γ, and increased susceptibility to infections. IFN-gamma R1 signaling pathway is important in activating cancer cell death and inhibiting cancer progression[3]
Mouse IFN-gamma R1 consists of extracellular domain (A26-S254), helical domain (I255-Y275), and cytoplasmic domain (W276-S477). The sequence of amino acids in IFNAR1 differs in different species. Mouse IFN-gamma R1 shares 50% aa sequence identity with human. IFN-gamma R1 plays a critical role in antimicrobial, antiviral, and antitumor responses[2].

In Vitro

IFN-gamma R1 (murine, 0-20 μg/mL, 4 h) suppresses AP(+)-exosome-mediated NO synthesis in RAW264.7 cells[4].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse IFNGR1 at 2 μg/mL (100 μl/well) can bind mouse IFN-gamma (HY-P7071). The ED50 for this effect is 98.32 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Mouse IFNGR1 at 2 μg/mL (100 μL/well) can bind mouse IFN-gamma (HY-P7071). The ED50 for this effect is 98.32 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P15261 (A26-D253)

Gene ID
Synonyms
Interferon gamma receptor 1; IFN-gamma-R1; IFN-gamma-R-alpha; CD119; Ifngr1
AA Sequence

ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKD

Molecular Weight

33-57 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-gamma R1/CD119 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma R1/CD119 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72611
Quantity:
MCE Japan Authorized Agent: