IFN-gamma R1/CD119 Protein, Mouse (228a.a, HEK293, His)

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma, IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate^[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54)^[2]. IFN-gamma R1/CD119 Protein, Mouse (228a.a, HEK 293, His) is a recombinant mouse IFN-gamma R1 (A26-D253) with C-terminal 6*His tag, which is produced in HEK293 cells.

IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 is constitutively expressed on the surface of almost all cells^[1].
IFN-gamma R1 can associate with IFN-gamma R2 to form a functional receptor. Upon binding with IFN-gamma, IFNγR1 and IFNγR2 oligomerize and transphosphorylate^[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. The phosphorylation of IFNγR1 creates a docking site for STAT1 and leads to the phosphorylation of STAT1. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). IFN-gamma R1 deficiencies are associated with immune responses mediated by IFN-γ, and increased susceptibility to infections. IFN-gamma R1 signaling pathway is important in activating cancer cell death and inhibiting cancer progression^[3]
Mouse IFN-gamma R1 consists of extracellular domain (A26-S254), helical domain (I255-Y275), and cytoplasmic domain (W276-S477). The sequence of amino acids in IFNAR1 differs in different species. Mouse IFN-gamma R1 shares 50% aa sequence identity with human. IFN-gamma R1 plays a critical role in antimicrobial, antiviral, and antitumor responses^[2].

IFN-gamma R1 (murine, 0-20 μg/mL, 4 h) suppresses AP(+)-exosome-mediated NO synthesis in RAW264.7 cells^[4].

Mouse

HEK293

C-6*His

P15261 (A26-D253)

15979  [NCBI]

ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKD

38-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Castro F, et al. Interferon-Gamma at the Crossroads of Tumor Immune Surveillance or Evasion. Front Immunol. 2018 May 4;9:847.  [Content Brief]

  [2]. van de Vosse E, et al. IFN-γR1 defects: Mutation update and description of the IFNGR1 variation database. Hum Mutat. 2017 Oct;38(10):1286-1296.  [Content Brief]

  [3]. Ding H, et al. Role of interferon-gamma (IFN-γ) and IFN-γ receptor 1/2 (IFNγR1/2) in regulation of immunity, infection, and cancer development: IFN-γ-dependent or independent pathway. Biomed Pharmacother. 2022 Nov;155:113683.  [Content Brief]

  [4]. Goto Y, et al. Contribution of the exosome-associated form of secreted endoplasmic reticulum aminopeptidase 1 to exosome-mediated macrophage activation. Biochim Biophys Acta Mol Cell Res. 2018 Jun;1865(6):874-888.  [Content Brief]