IFN-lambda 1/IL-29 Protein, Human (HEK293)

IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When IFN-lambda 1 binds with the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1, and activation of STAT1 and STAT2^[1]. IFN-lambda 1 modulates immunity in infections and autoimmune diseases^[2]. IFN-lambda 1/IL-29 Protein, Human (HEK293) is a recombinant human IFN-lambda 1 (G20-T200) without any tag, which is produced in HEK293 cell.

IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 is produced mainly by maturing dendritic cells and macrophages. Maturing dendritic cells, macrophages, mast cells, and alveolar cells express high levels of IFN-lambda 1^[3].
IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When binding to the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1 (intracellular domain, Tyr406 and Tyr343, Tyr517), and activation of STAT1 and STAT2^[1]. Activated STAT1 and STAT2 recruits IRF-9 to form a trimeric transcription factor complex (ISGF3), which mediates the antiviral state^[4].
IFN-lambda 1 modulates immunity in infections and autoimmune diseases^[2].

IFN-lambda 1 (human, 1-1 ng/mL, 48 h) increases the expression of proinflammatory cytokine in osteoarthritis (OA) synovial fibroblasts (FLS)^[5].
IFN-lambda 1 (human, -2 ng/mL, 24h) increases expression of the proinflammatory factor IL-8 in human blood monocyte-derived DCs^[6].

Measured in antiviral assays using HepG2 cells infected with vesicular stomatitis virus and the ED₅₀ is typically 3-39 ng/mL.

Human

HEK293

Tag Free

Q8IU54 (G20-T200)

282618  [NCBI]

MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Approximately 20.2 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Donnelly RP, et al. Interferon-lambda: a new addition to an old family. J Interferon Cytokine Res. 2010 Aug;30(8):555-64.  [Content Brief]

  [2]. Wu Q, et al. Serum IFN-λ1 is abnormally elevated in rheumatoid arthritis patients. Autoimmunity. 2013 Feb;46(1):40-3.  [Content Brief]

  [3]. Kelm NE, et al. The role of IL-29 in immunity and cancer. Crit Rev Oncol Hematol. 2016 Oct;106:91-8.  [Content Brief]

  [4]. Lopušná K, et al. Interferons lambda, new cytokines with antiviral activity. Acta Virol. 2013;57(2):171-9.  [Content Brief]

  [5]. Xu L, et al. Interleukin-29 Enhances Synovial Inflammation and Cartilage Degradation in Osteoarthritis. Mediators Inflamm. 2016;2016:9631510.  [Content Brief]

  [6]. Yu Y, et al. Hepatitis B virus induces a novel inflammation network involving three inflammatory factors, IL-29, IL-8, and cyclooxygenase-2. J Immunol. 2011 Nov 1;187(9):4844-60.  [Content Brief]