2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Interferon & Receptors
  5. IFN-ω
  6. IFN-omega 1 Protein, Bovine (His-SUMO)

IFN-omega 1 Protein, Bovine (His-SUMO)

Cat. No.: HY-P72246
Handling Instructions

IFN-omega 1 protein is a member of the alpha/beta interferon family. IFN-omega 1 Protein, Bovine (His-SUMO) is the recombinant bovine-derived IFN-omega 1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of IFN-omega 1 Protein, Bovine (His-SUMO) is 172 a.a., with molecular weight of ~35.7 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-omega 1 protein is a member of the alpha/beta interferon family. IFN-omega 1 Protein, Bovine (His-SUMO) is the recombinant bovine-derived IFN-omega 1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of IFN-omega 1 Protein, Bovine (His-SUMO) is 172 a.a., with molecular weight of ~35.7 kDa.
Background

IFN-omega 1 protein belongs to the alpha/beta interferon family.
Species

Bovine
Source

E. coli
Tag

N-6*His;N-SUMO
Accession

P07352 (C24-P195)
Gene ID
Molecular Construction
N-term
6*His-SUMO
IFN-omega 1 (C24-P195)
Accession # P07352
C-term
Synonyms
IFNW1; IFNW; Interferon omega-1; IFN-omega-c1; Interferon alpha-II-1
AA Sequence

CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQEAQAISVLHEMLQQSFNLFHKERSSAAWDTTLLEQLLTGLHQQLDDLDACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCAWEIVRLEIMRSLSSSTSLQERLRMMDGDLKSP

Molecular Weight

Approximately 35.7 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

IFN-omega 1 Protein, Bovine (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-omega 1 Protein, Bovine (His-SUMO)
Cat. No.:
HY-P72246
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.