IFN-omega Protein, Human

IFN-omega Protein, Human has antiviral, anti-proliferation, and antitumor activities that are similar to those of IFN-α.

Interferon-omega (IFN-omega), a type I interferon, is a monomeric glycoprotein distantly related in structure to IFN-alpha and IFN-beta, but unrelated to IFN-gamma. The human type I interferon receptor complex, which mediates the biological activity of IFN-alpha and IFN-beta, also binds IFN-omega. IFN-omega is secreted by virus-infected leukocytes. Human IFN-ω binds to the α/β receptor but not to the interferon γ receptor^[1]. IFN-omega has antiviral function on hepatitis B virus replication in human hepatoma cells^[2]. IFN-ω also has been explored as a treatment option for some diseases or viral infections in humans and other animals^[3].

Human

E. coli

Tag Free

P05000 (C24-S195)

3467  [NCBI]

CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS

Approximately 20.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Flores, et al. Human interferon omega (omega) binds to the alpha/beta receptor. J Biol Chem. 1991 Oct 25;266(30):19875-7.  [Content Brief]

  [2]. Hagelstein J, et al. Antiviral potential of interferon-omega on hepatitis B virus replication in human hepatoma cells. Arzneimittelforschung. 1998 Mar;48(3):343-7.  [Content Brief]

  [3]. Li SF, et al. Interferon-omega: Current status in clinical applications. Int Immunopharmacol. 2017 Nov;52:253-260.  [Content Brief]