1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-ω
  5. IFN-omega 1 Protein, Human

IFN-omega 1 Protein, Human has antiviral, anti-proliferation, and antitumor activities that are similar to those of IFN-α.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-omega 1 Protein, Human has antiviral, anti-proliferation, and antitumor activities that are similar to those of IFN-α.

Background

Interferon-omega (IFN-omega), a type I interferon, is a monomeric glycoprotein distantly related in structure to IFN-alpha and IFN-beta, but unrelated to IFN-gamma. The human type I interferon receptor complex, which mediates the biological activity of IFN-alpha and IFN-beta, also binds IFN-omega. IFN-omega is secreted by virus-infected leukocytes. Human IFN-ω binds to the α/β receptor but not to the interferon γ receptor[1]. IFN-omega has antiviral function on hepatitis B virus replication in human hepatoma cells[2]. IFN-ω also has been explored as a treatment option for some diseases or viral infections in humans and other animals[3].

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P05000 (C24-S195)

Gene ID
Synonyms
rHuIFN-ω; Interferon omega-1; IFNW1
AA Sequence

CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS

Molecular Weight

Approximately 20.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IFN-omega 1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-omega 1 Protein, Human
Cat. No.:
HY-P7201
Quantity:
MCE Japan Authorized Agent: