1. Recombinant Proteins
  2. Fc Receptors
  3. Immunoglobulin Fc Region
  4. Ig Lambda Constant 2 Protein, Human (HEK293, His)

Ig Lambda Constant 2 Protein, Human (HEK293, His)

Cat. No.: HY-P70278
Handling Instructions Technical Support

The Ig Lambda Constant 2 protein is part of the constant region of the immunoglobulin light chain. It acts as a receptor during the recognition phase of humoral immunity, triggering B lymphocyte expansion and differentiation into plasma cells. Ig Lambda Constant 2 Protein, Human (HEK293, His) is the recombinant human-derived Ig Lambda Constant 2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Ig Lambda Constant 2 Protein, Human (HEK293, His) is 106 a.a., with molecular weight of ~16.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Ig Lambda Constant 2 protein is part of the constant region of the immunoglobulin light chain. It acts as a receptor during the recognition phase of humoral immunity, triggering B lymphocyte expansion and differentiation into plasma cells. Ig Lambda Constant 2 Protein, Human (HEK293, His) is the recombinant human-derived Ig Lambda Constant 2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Ig Lambda Constant 2 Protein, Human (HEK293, His) is 106 a.a., with molecular weight of ~16.0 kDa.

Background

The constant region of immunoglobulin light chains, specifically Ig Lambda Constant 2 protein, is integral to the structure of antibodies, also known as immunoglobulins. These membrane-bound or secreted glycoproteins are produced by B lymphocytes and function as receptors in the recognition phase of humoral immunity. Upon binding a specific antigen, membrane-bound immunoglobulins instigate the clonal expansion and differentiation of B lymphocytes into plasma cells that secrete immunoglobulins. Secreted immunoglobulins, in turn, play a pivotal role in the effector phase of humoral immunity, facilitating the elimination of bound antigens. The antigen binding site is orchestrated by the variable domain of one heavy chain, coupled with that of its associated light chain, resulting in each immunoglobulin possessing two antigen binding sites with remarkable affinity for a particular antigen. The variable domains undergo V-(D)-J rearrangement and subsequent somatic hypermutations, enabling affinity maturation after exposure to antigen and selection. Immunoglobulins are composed of two identical heavy chains and two identical light chains, interconnected by disulfide linkages.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P0DOY2 (G1-S106)

Gene ID
Molecular Construction
N-term
IGLC2 (G1-S106)
Accession # P0DOY2
6*His
C-term
Synonyms
rHuImmunoglobulin lambda constant 2, His; Ig lambda constant 2; Immunoglobulin Lambda Constant 2; Ig Lambda C Domain; IGLC; IGLC2; immunoglobulin lambda constant 2 (Kern-Oz- marker); MGC20392; MGC45681
AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ig Lambda Constant 2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ig Lambda Constant 2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70278
Quantity:
MCE Japan Authorized Agent: