IgE Protein, Human (HEK293, His)

IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation. IgE Protein, Human (HEK293, His) is the recombinant human-derived IgE protein, expressed by HEK293 , with C-His labeled tag. The total length of IgE Protein, Human (HEK293, His) is 220 a.a., with molecular weight of ~26-35 kDa.

The IgE protein, a crucial component of immunoglobulins, functions in both the recognition and effector phases of humoral immunity. Serving as a membrane-bound receptor on B lymphocytes during the recognition phase, IgE plays a pivotal role in triggering clonal expansion and differentiation into immunoglobulin-secreting plasma cells upon specific antigen binding. In the effector phase, secreted IgE mediates immune responses through two Fc receptors, FCER1A:MS4A2:FCGR1A and FCER2, which, upon antigen cross-linking, initiate signaling pathways leading to immune cell activation. IgE facilitates immediate hypersensitivity responses against allergens and defends against helminth parasites, bacteria, and venom toxicity. Dysregulation can lead to harmful allergic reactions and anaphylaxis. IgE stimulates mast cells, basophils, and eosinophils to release inflammatory mediators, contributing to tissue remodeling and cytotoxicity against microbes. On macrophages, IgE induces intracellular killing of parasites and activates antitumor functions, including antibody-dependent cytotoxicity and proinflammatory responses. Additionally, IgE plays a role in B cell antigen uptake and presentation to T cells.

Human

HEK293

C-His

AAB59395 (C208-K427)

/

CADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGK

Approximately 26-35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.