1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFBP-1
  5. IGFBP-1 Protein, Canine (HEK293, His)

IGFBP-1 Protein, Canine (HEK293, His)

Cat. No.: HY-P74849
COA Handling Instructions

IGFBP-1 Protein is a member of the insulin-like growth factor binding protein (IGFBP) family that binds insulin-like growth factor (IGFs) I and II to extend the half-life of IGFs. IGFBP-1 inhibits proliferation, invasion, migration and apoptosis of HTR-8/SVneo cells by inducing MMP-26 expression. IGFBP1 may be a new prognostic factor and a target of molecular targeted therapy for gastric cancer. IGFBP-1 Protein, Canine (HEK293, His) is the recombinant canine-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $80 In-stock
50 μg $220 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGFBP-1 Protein is a member of the insulin-like growth factor binding protein (IGFBP) family that binds insulin-like growth factor (IGFs) I and II to extend the half-life of IGFs. IGFBP-1 inhibits proliferation, invasion, migration and apoptosis of HTR-8/SVneo cells by inducing MMP-26 expression. IGFBP1 may be a new prognostic factor and a target of molecular targeted therapy for gastric cancer. IGFBP-1 Protein, Canine (HEK293, His) is the recombinant canine-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Insulin-like growth factor-binding protein 1 (IBP-1), also known as placental protein 12 (PP12), It's a protein encoded by the IGFBP1 gene. Igfbp-1 is a member of the insulin-like growth factor binding protein (IGFBP) family that binds insulin-like growth factor (IGFs) I and II and circulates in plasma. The binding of the IGFBP-1 protein prolongs the half-life of IGFs and alters their interaction with cell surface receptors. IGFBP-1 can promote cell migration and has the same binding affinity for IGF1 and IGF2. IGFBP-1 inhibits proliferation, invasion, migration and apoptosis of HTR-8/SVneo cells by inducing MMP-26 expression. IGFBP1 may be a new prognostic factor and a target of molecular targeted therapy for gastric cancer[1][2][3].

Biological Activity

Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED 50 this effect is 0.5299 µg/mL, corresponding to a specific activity is 1.887×103 U/mg.

  • Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED50 this effect is 0.5299 µg/mL, corresponding to a specific activity is 1.887×103 U/mg.
Species

Canine

Source

HEK293

Tag

C-6*His

Accession

A0A8I3NJH1/XP_005629556.1 (T26-S249)

Gene ID

480812  [NCBI]

Molecular Construction
N-term
IGFBP-1 (T26-S249)
Accession # A0A8I3NJH1/XP_005629556.1
His
C-term
Synonyms
Insulin-like growth factor-binding protein 1; PP12; IBP-1;
AA Sequence

TPQPWHCAPCTPEKLALCPPVPASCAETALPAGCGCCPMCALPQDAPCGVATARCATGLSCRAAPGEERPLHALIRGRGVCVPTDPAADAKESSESSEITQEQLLENFHLMVPSEEDTPILWNAVRNYKTVRSDDSDKLKEPCRRELHEVLARLAEEQASRQLYSFYLPNCNKNGFYHSRQCKTAMDGQRGLCWCVYPWNGERIPGSVEVRGDPNCGQYFTGHS

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IGFBP-1 Protein, Canine (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGFBP-1 Protein, Canine (HEK293, His)
Cat. No.:
HY-P74849
Quantity:
MCE Japan Authorized Agent: