1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFBP-6
  5. IGFBP-6 Protein, Mouse (HEK293, His)

IGFBP-6 protein can extend the half-life of IGF and regulate its effects. It can inhibit or stimulate the growth-promoting effects of IGF. IGFBP-6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-6 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IGFBP-6 Protein, Mouse (HEK293, His) is 213 a.a., with molecular weight of ~28.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

IGFBP-6 Protein, Mouse (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGFBP-6 protein can extend the half-life of IGF and regulate its effects. It can inhibit or stimulate the growth-promoting effects of IGF. IGFBP-6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-6 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IGFBP-6 Protein, Mouse (HEK293, His) is 213 a.a., with molecular weight of ~28.0 kDa.

Background

IGFBP-6 protein assumes a pivotal role in regulating the activity of insulin-like growth factors (IGFs) by extending their half-life. In cell culture, IGFBP-6 has been demonstrated to exert a dual regulatory influence, capable of either inhibiting or stimulating the growth-promoting effects of IGFs. This versatile function underscores the complexity of IGFBP-6 in modulating cellular processes. Furthermore, IGFBP-6 plays a role in altering the interaction between IGFs and their cell surface receptors. Beyond its role in IGF regulation, IGFBP-6 actively participates in cellular signaling by activating the MAPK pathway and inducing cell migration. Notably, it interacts with PHB2 via its C-terminal domain, highlighting its involvement in intricate protein-protein interactions that contribute to the multifaceted cellular responses associated with growth regulation and migration.

Biological Activity

Measured by its ability to inhibit the biological activity of IGF-I on MCF-7 human breast cancer cells. The ED50 for this effect is 1.265 µg/mL, corresponding to a specific activity is 790.6 U/mg.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P47880 (A26-G238)

Gene ID
Molecular Construction
N-term
IGFBP-6 (A26-G238)
Accession # P47880
6*His
C-term
Synonyms
rMuInsulin-like growth factor-binding protein 6/IGFBP-6, His; Insulin-like growth factor-binding protein 6; IBP-6; IGF-binding protein 6; IGFBP-6; Igfbp6; IBP6; IGF binding protein 6; insulin-like growth factor-binding protein 6
AA Sequence

ALAGCPGCGAGMQTGCRGGCVEEEDAGSPADGCTEAGGCLRREGQPCGVYSPKCAPGLQCQPRENEEAPLRALLIGQGRCQRARGPSEETTKESKPQGGASRSRDTNHRDRQKNPRTSAAPIRPNPVQDSEMGPCRRHLDSVLQQLQTEVFRGGARGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSTQCSARSSG

Molecular Weight

Approximately 28.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

IGFBP-6 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGFBP-6 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70357
Quantity:
MCE Japan Authorized Agent: