IGFBP-6 Protein, Rat (HEK293, His)

IGFBP-6 protein modulates IGFs' activity, extending their half-life and exhibiting dual regulatory capacity.It activates the MAPK pathway, induces cell migration, and interacts with PHB2.These diverse functions emphasize IGFBP-6's multifaceted role in cellular responses related to growth regulation, signaling, and migration.IGFBP-6 Protein, Rat (HEK293, His) is the recombinant rat-derived IGFBP-6 protein, expressed by HEK293 , with C-His labeled tag.

IGFBP-6 protein assumes a crucial role in modulating the activity of insulin-like growth factors (IGFs) by extending their half-life. Demonstrating a dual regulatory capacity in cell culture, IGFBP-6 can either inhibit or stimulate the growth-promoting effects of IGFs, reflecting its versatile influence on cellular processes. Beyond its impact on IGFs, IGFBP-6 actively participates in cellular signaling by activating the MAPK pathway and promoting cell migration. Notably, it interacts with PHB2 through its C-terminal domain, emphasizing its involvement in intricate protein-protein interactions. These diverse functions highlight the multifaceted role of IGFBP-6 in orchestrating cellular responses associated with growth regulation, signaling, and migration.

Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED₅₀ for this effect is 0.1026 µg/mL, corresponding to a specific activity is 9746.5887 U/mg.

• 
  Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED₅₀ for this effect is 0.1026 µg/mL, corresponding to a specific activity is 9746.5887 U/mg.

Rat

HEK293

C-6*His

P35572/NP_037236.1 (A26-G226)

25641  [NCBI]

ALAGCPGCGPGVQEEDAGSPADGCAETGGCFRREGQPCGVYIPKCAPGLQCQPRENEETPLRALLIGQGRCQRARGPSEETTKESKPHGGASRPRDRDRQKNPRTSAAPIRPSPVQDGEMGPCRRHLDSVLQQLQTEVFRGGANGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSSQCSARSSG

Approximately 25-30 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.