IGFBP-7 Protein, Mouse (HEK293, Fc)

IGFBP-7 Protein is a member of the insulin-like growth factor binding protein (IGFBP) Family. The major function of IGFBP-7 is the regulation of availability of insulin-like growth factors (IGFs) in tissue as well as in modulating IGF binding to its receptors. IGFBP7 exhibits a relatively low affinity for binding to both IGF-I and IGF-II. Furthermore, it has the capacity to stimulate the production of prostacyclin (PGI2) and enhance cell adhesion. IGFBP-7 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IGFBP-7 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IGFBP-7 Protein, Mouse (HEK293, Fc) is 256 a.a., with molecular weight of ~53.3-60 kDa.

Insulin-like growth factor binding protein 7 (IGFBP-7) is a member of the IGFBP Family. IGFBP-7 is high expressed in liver, kidney, bone and muscle, and the expression level is higher in renal tubules. IGFBP7 exhibits a relatively low affinity for binding to both IGF-I and IGF-II compared to IGFBPs 1-6. Furthermore, it has the capacity to stimulate the production of prostacyclin (PGI2) and enhance cell adhesion. IGFBP-7 interacts with Insulin-like growth factor 1, VPS24, and the IGF-1 receptor. Its wider distribution in normal tissue and lower expression in several cancer cells indicate that IGFBP-7 may function as a growth-suppressing factor, as well as an IGF-binding protein^[1][2][3].

Measured by its binding ability in a functional ELISA. Immobilized mouse IGFBP-7 at 0.5 μg/mL (100 μL/well) can bind biotinylated CCL21. The ED₅₀ for this effect is 8.153 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized mouse IGFBP-7 at 0.5 μg/mL (100μL/well) can bind biotinylated CCL21. The ED₅₀ for this effect is 8.153 ng/mL.

Mouse

HEK293

C-hFc

AAH92538.1 (S26-L281)

29817  [NCBI]

SSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL

Approximately 53.3-60 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.