IGFBP-1 Protein, Rhesus Macaque (HEK293, His)

IGFBP-1 Protein, a member of the insulin-like growth factor-binding protein (IGFBP) family, extends IGFs' half-life and modulates their growth-promoting effects on cell culture, inhibiting or stimulating these responses. Crucially, it alters the interaction between IGFs and their cell surface receptors and promotes cell migration. Notably versatile, IGFBP-1 shows equal binding affinity for both IGF1 and IGF2, underscoring its diverse role in modulating the biological activities of insulin-like growth factors. IGFBP-1 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of IGFBP-1 Protein, Rhesus Macaque (HEK293, His) is 234 a.a., with molecular weight of ~30 kDa.

Insulin-like growth factor-binding protein 1 (IGFBP-1), a member of the insulin-like growth factor-binding protein (IGFBP) family, contributes to the regulation of IGFs by extending their half-life and modulating their growth-promoting effects on cell culture, either inhibiting or stimulating these effects. This protein plays a crucial role in altering the interaction between IGFs and their cell surface receptors. Additionally, IGFBP-1 demonstrates the ability to promote cell migration, indicating its involvement in cellular processes beyond growth regulation. Notably, it exhibits equal binding affinity for both IGF1 and IGF2, highlighting its versatile role in modulating the biological activities of insulin-like growth factors^[1].

Measured by its binding ability in a functional ELISA. When Recombinant Rhesus IGFBP1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant human IGF1. The ED₅₀ for this effect is 81.21 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Rhesus IGFBP1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant human IGF1. The ED₅₀ for this effect is 81.21 ng/mL.

Rhesus Macaque

HEK293

C-His

XP_001085935 (A48-N281)

696994  [NCBI]

APWQCAPCSAEKLALCPPVPASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQDSDASASNAEAAGSPESPESTEITEEELLDNFHLMAPSEEDHSTLWDAIGTYDSSKAVHVTNVKKWKEPCRIELYRVVESLTKAQETSGEDISKFYLPNCNKNGFYHSRQCETSLAGEERLCWCVYPWNGKRIPGSPEIRGDPNCQTYFNVQN

Approximately 30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.