1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFBP-1
  5. IGFBP-1 Protein, Rhesus Macaque (HEK293, His)

IGFBP-1 Protein, a member of the insulin-like growth factor-binding protein (IGFBP) family, extends IGFs' half-life and modulates their growth-promoting effects on cell culture, inhibiting or stimulating these responses. Crucially, it alters the interaction between IGFs and their cell surface receptors and promotes cell migration. Notably versatile, IGFBP-1 shows equal binding affinity for both IGF1 and IGF2, underscoring its diverse role in modulating the biological activities of insulin-like growth factors. IGFBP-1 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of IGFBP-1 Protein, Rhesus Macaque (HEK293, His) is 234 a.a., with molecular weight of ~30 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGFBP-1 Protein, a member of the insulin-like growth factor-binding protein (IGFBP) family, extends IGFs' half-life and modulates their growth-promoting effects on cell culture, inhibiting or stimulating these responses. Crucially, it alters the interaction between IGFs and their cell surface receptors and promotes cell migration. Notably versatile, IGFBP-1 shows equal binding affinity for both IGF1 and IGF2, underscoring its diverse role in modulating the biological activities of insulin-like growth factors. IGFBP-1 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of IGFBP-1 Protein, Rhesus Macaque (HEK293, His) is 234 a.a., with molecular weight of ~30 kDa.

Background

Insulin-like growth factor-binding protein 1 (IGFBP-1), a member of the insulin-like growth factor-binding protein (IGFBP) family, contributes to the regulation of IGFs by extending their half-life and modulating their growth-promoting effects on cell culture, either inhibiting or stimulating these effects. This protein plays a crucial role in altering the interaction between IGFs and their cell surface receptors. Additionally, IGFBP-1 demonstrates the ability to promote cell migration, indicating its involvement in cellular processes beyond growth regulation. Notably, it exhibits equal binding affinity for both IGF1 and IGF2, highlighting its versatile role in modulating the biological activities of insulin-like growth factors[1].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Rhesus IGFBP1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant human IGF1. The ED50 for this effect is 81.21 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Rhesus IGFBP1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant human IGF1. The ED50 for this effect is 81.21 ng/mL.
Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

XP_001085935 (A48-N281)

Gene ID
Molecular Construction
N-term
IGFBP-1 (A48-N281)
Accession # XP_001085935
His
C-term
Synonyms
Insulin-like growth factor-binding protein 1; IGFBP1
AA Sequence

APWQCAPCSAEKLALCPPVPASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQDSDASASNAEAAGSPESPESTEITEEELLDNFHLMAPSEEDHSTLWDAIGTYDSSKAVHVTNVKKWKEPCRIELYRVVESLTKAQETSGEDISKFYLPNCNKNGFYHSRQCETSLAGEERLCWCVYPWNGKRIPGSPEIRGDPNCQTYFNVQN

Molecular Weight

Approximately 30 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IGFBP-1 Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGFBP-1 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P74848
Quantity:
MCE Japan Authorized Agent: