IGF2BP2 Protein, Human (T7-His)

The IGF2BP2 protein is an RNA-binding factor that coordinates the recruitment of target transcripts into cytoplasmic mRNP, promoting mRNA transport and transient storage. It regulates the contact of target transcripts with the translation machinery and protects them from microRNA-mediated degradation. IGF2BP2 Protein, Human (T7-His) is the recombinant human-derived IGF2BP2 protein, expressed by E. coli , with N-T7, C-6*His labeled tag.

The IGF2BP2 protein functions as an RNA-binding factor, orchestrating the recruitment of target transcripts into cytoplasmic protein-RNA complexes (mRNPs). This 'caging' of transcripts within mRNPs facilitates mRNA transport and transient storage while modulating the rate and location of target transcripts encountering the translational apparatus. Moreover, IGF2BP2 shields these transcripts from endonuclease attacks or degradation mediated by microRNAs. With a preference for N6-methyladenosine (m6A)-containing mRNAs, IGF2BP2 enhances their stability. It exhibits specific binding to the 5'-UTR of insulin-like growth factor 2 (IGF2) mRNAs and selectively binds to transcripts like beta-actin/ACTB and MYC, increasing MYC mRNA stability through interaction with the coding region instability determinant (CRD). IGF2BP2 can form homooligomers and heterooligomers with IGF2BP1 and IGF2BP3 in an RNA-dependent manner and interacts with various proteins, including HNRPD, IGF2BP1, ELAVL1, DHX9, HNRNPU, MATR3, and PABPC1. Its interaction with the HOXB-AS3 peptide further enhances MYC stability.

Human

E. coli

N-T7;C-6*His

Q9Y6M1-2 (M1-T220)

10644  [NCBI]

MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNIT

Approximately 43.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.