IGFL1 Protein, Human (HEK293, hFc)

The IGFL1 protein is a possible ligand of the IGFLR1 receptor and mediates cellular responses through receptor binding. As a homodimer with disulfide bonds, the structural arrangement of IGFL1 suggests involvement in specific signaling events. IGFL1 Protein, Human (HEK293, hFc) is the recombinant human-derived IGFL1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IGFL1 Protein, Human (HEK293, hFc) is 86 a.a., with molecular weight of 42 kDa.

The IGFL1 protein is identified as a probable ligand for the IGFLR1 cell membrane receptor, indicating its role in mediating cellular responses through receptor binding. Existing as a homodimer with disulfide linkages, IGFL1 showcases a structural arrangement that suggests its potential involvement in specific signaling events upon binding to its cognate receptor. The homodimeric nature of IGFL1 underlines its capacity for complex interactions, emphasizing its potential significance in cellular communication and signaling pathways mediated by the IGFLR1 receptor. Further investigations into the precise mechanisms and downstream effects of the IGFL1-IGFLR1 interaction will provide valuable insights into the functional roles of this ligand-receptor pair.

Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 5 μg/mL can bind IGFL1 Protein, Human (HEK293, hFc), the EC₅₀ is ≤ 55 ng/mL.

Human

HEK293

C-hFc

Q6UW32 (A25-S110)

374918  [NCBI]

APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

42 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.