1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFL1 Protein, Human (HEK293, hFc)

IGFL1 Protein, Human (HEK293, hFc)

Cat. No.: HY-P700450
SDS COA Handling Instructions

The IGFL1 protein is a possible ligand of the IGFLR1 receptor and mediates cellular responses through receptor binding. As a homodimer with disulfide bonds, the structural arrangement of IGFL1 suggests involvement in specific signaling events. IGFL1 Protein, Human (HEK293, hFc) is the recombinant human-derived IGFL1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IGFL1 Protein, Human (HEK293, hFc) is 86 a.a., with molecular weight of 42 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $230 In-stock
50 μg $440 In-stock
100 μg $700 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IGFL1 protein is a possible ligand of the IGFLR1 receptor and mediates cellular responses through receptor binding. As a homodimer with disulfide bonds, the structural arrangement of IGFL1 suggests involvement in specific signaling events. IGFL1 Protein, Human (HEK293, hFc) is the recombinant human-derived IGFL1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IGFL1 Protein, Human (HEK293, hFc) is 86 a.a., with molecular weight of 42 kDa.

Background

The IGFL1 protein is identified as a probable ligand for the IGFLR1 cell membrane receptor, indicating its role in mediating cellular responses through receptor binding. Existing as a homodimer with disulfide linkages, IGFL1 showcases a structural arrangement that suggests its potential involvement in specific signaling events upon binding to its cognate receptor. The homodimeric nature of IGFL1 underlines its capacity for complex interactions, emphasizing its potential significance in cellular communication and signaling pathways mediated by the IGFLR1 receptor. Further investigations into the precise mechanisms and downstream effects of the IGFL1-IGFLR1 interaction will provide valuable insights into the functional roles of this ligand-receptor pair.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 5 μg/mL can bind IGFL1 Protein, Human (HEK293, hFc), the EC50 is ≤ 55 ng/mL.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q6UW32 (A25-S110)

Gene ID
Molecular Construction
N-term
IGFL1 (A25-S110)
Accession # Q6UW32
hFc
C-term
Synonyms
UNQ644; APRG644
AA Sequence

APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Molecular Weight

42 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IGFL1 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGFL1 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P700450
Quantity:
MCE Japan Authorized Agent: