1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFL1 Protein, Mouse (His-SUMO)

IGFL1 Protein likely acts as a ligand for the IGFLR1 cell membrane receptor, forming a homodimer through disulfide bonds. IGFL1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived IGFL1 protein, expressed by E. coli, with N-SUMO, N-6*His labeled tag. The total length of IGFL1 Protein, Mouse (His-SUMO) is 116 a.a., with molecular weight of 26.1 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGFL1 Protein likely acts as a ligand for the IGFLR1 cell membrane receptor, forming a homodimer through disulfide bonds. IGFL1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived IGFL1 protein, expressed by E. coli, with N-SUMO, N-6*His labeled tag. The total length of IGFL1 Protein, Mouse (His-SUMO) is 116 a.a., with molecular weight of 26.1 kDa.

Background

IGFL1 protein is a probable ligand for the IGFLR1 cell membrane receptor. It exists as a homodimer, connected by disulfide bonds.

Species

Mouse

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q6B9Z0 (R25-P140)

Gene ID
Molecular Construction
N-term
6*His-SUMO
IGFL1 (R25-P140)
Accession # Q6B9Z0
C-term
Synonyms
UNQ644; APRG644
AA Sequence

RKISTFSGPGSWPCNPKCDGRTYNPSEECCVHDTILPFKRINLCGPSCTYRPCFELCCPESYSPKKKFIVKLKVHGERSHCSSSPISRNCKSNKIFHGEDIEDNQLSLRKKSGDQP

Molecular Weight

26.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IGFL1 Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGFL1 Protein, Mouse (His-SUMO)
Cat. No.:
HY-P700492
Quantity:
MCE Japan Authorized Agent: