IGFL2 Protein, Human (HEK293, N-hFc)

The IGFL2 protein emerged as a potential ligand for the IGFLR1 cell membrane receptor, suggesting a role in mediating cell signaling events. As a putative ligand, IGFL2 is primed to interact with the IGFLR1 receptor, suggesting involvement in cellular responses and signaling cascades. IGFL2 Protein, Human (HEK293, N-hFc) is the recombinant human-derived IGFL2, expressed by HEK293 , with N-hFc labeled tag. The total length of IGFL2 Protein, Human (HEK293, N-hFc) is 94 a.a.,

IGFL2 Protein emerges as a potential ligand for the IGFLR1 cell membrane receptor, indicating a potential role in mediating cell signaling events. As a putative ligand, IGFL2 is poised to interact with the IGFLR1 receptor on the cell membrane, suggesting involvement in cellular responses and signaling cascades. The identification of IGFL2 as a potential ligand underscores its significance in cell communication and regulatory processes, highlighting the need for further exploration to unravel the specific molecular interactions and functions that IGFL2 may exert in various cellular contexts.

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IGFLR1 at 2 µg/mL can bind Human IGFL2. The ED₅₀ for this effect is 1.811 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IGFLR1 at 2 µg/mL can bind Human IGFL2. The ED₅₀ for this effect is 1.811 μg/mL..

Human

HEK293

N-hFc

Q6UWQ7-1 (P26-P119)

147920

PAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP

Approximately 40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.