IGFLR1 Protein, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

The IGFLR1 protein emerges as a probable cell membrane receptor for the IGF-like family proteins, demonstrating a specific affinity for IGFL1 and IGFL3, with a higher binding affinity compared to other family members. This suggests a selective interaction profile between IGFLR1 and these ligands. Furthermore, IGFLR1 may also exhibit the capacity to bind IGFL2, further expanding its potential ligand repertoire. The distinctive binding preferences underscore the receptor's role in mediating cellular responses to IGF-like family proteins, highlighting its significance in the intricate network of cellular signaling pathways.

Human

HEK293

C-6*His

Q9H665-1 (S23-P163)

79713  [NCBI]

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

17.4 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.