1. Recombinant Proteins
  2. Fc Receptors
  3. Immunoglobulin Fc Region
  4. IgG
  5. IgG Protein, Rabbit (T185A, N284S, HEK293)

IgG Protein, Rabbit (T185A, N284S, HEK293)

Cat. No.: HY-P73904
SDS COA Handling Instructions

IgG protein, exhibits the D12 allotypic marker with the 104-Thr sequence and the E14 marker with 185-Thr. IgG Protein, Rabbit (T185A, N284S, HEK293) is the recombinant Rabbit-derived IgG protein, expressed by HEK293 , with tag free. The total length of IgG Protein, Rabbit (T185A, N284S, HEK293) is 223 a.a., with molecular weight of 30-38 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IgG protein, exhibits the D12 allotypic marker with the 104-Thr sequence and the E14 marker with 185-Thr. IgG Protein, Rabbit (T185A, N284S, HEK293) is the recombinant Rabbit-derived IgG protein, expressed by HEK293 , with tag free. The total length of IgG Protein, Rabbit (T185A, N284S, HEK293) is 223 a.a., with molecular weight of 30-38 kDa.

Background

IgG protein, exhibits the D12 allotypic marker with the 104-Thr sequence and the E14 marker with 185-Thr.

Biological Activity

Immobilized Rabbit IgG, No Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human Fc gamma RI, His Tag with the EC50 of 10.5 ng/mL determined by ELISA.

Species

Rabbit

Source

HEK293

Tag

Tag Free

Accession

P01870 (S101-K323, T185A, N284S)

Gene ID

100009097  [NCBI]

Molecular Construction
N-term
IgG (S101-K323, T185A, N284S)
Accession # P01870
C-term
Synonyms
Ig gamma chain C region; IgG
AA Sequence

SKPTCPPPELLGGPSVFIFPPKPKDTLMISRTPEVTCVVVDVSQDDPEVQFTWYINNEQVRTARPPLREQQFNSTIRVVSTLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKARGQPLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVEWEKNGKAEDNYKTTPAVLDSDGSYFLYSKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK

Molecular Weight

30-38 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as 0.22 μm filtered solution in PBS, 150mM Nacl, 10% Glycerol (pH 7.4).

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

IgG Protein, Rabbit (T185A, N284S, HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IgG Protein, Rabbit (T185A, N284S, HEK293)
Cat. No.:
HY-P73904
Quantity:
MCE Japan Authorized Agent: