1. Recombinant Proteins
  2. Fc Receptors
  3. Immunoglobulin Fc Region
  4. IgG2
  5. IgG2 Fc Protein, Human (V161M, S257A, HEK293)

IgG2 Fc Protein, Human (V161M, S257A, HEK293)

Cat. No.: HY-P72605
Handling Instructions Technical Support

The IgG2 Fc protein is the constant region of the immunoglobulin heavy chain and acts as an antigen receptor, triggering the expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells.IgG2 Fc Protein, Human (V161M, S257A, HEK293) is the recombinant human-derived IgG2 Fc protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IgG2 Fc protein is the constant region of the immunoglobulin heavy chain and acts as an antigen receptor, triggering the expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells.IgG2 Fc Protein, Human (V161M, S257A, HEK293) is the recombinant human-derived IgG2 Fc protein, expressed by HEK293 , with tag free.

Background

The constant region of immunoglobulin heavy chains, referred to as antibodies, comprises membrane-bound or secreted glycoproteins synthesized by B lymphocytes. In the recognition phase of humoral immunity, these membrane-bound immunoglobulins act as receptors, triggering clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells upon binding specific antigens. The effector phase, mediated by secreted immunoglobulins, leads to the elimination of bound antigens. The antigen binding site is shaped by the variable domain of one heavy chain, along with that of its associated light chain, resulting in each immunoglobulin possessing two antigen binding sites with remarkable affinity for a particular antigen. Variable domains undergo V-(D)-J rearrangement and subsequent somatic hypermutations, facilitating affinity maturation for a specific antigen following exposure and selection. Immunoglobulins consist of two identical heavy chains and two identical light chains, interconnected by disulfide linkages.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P01859-1 (E99-K326, V161M, S257A)

Gene ID
Synonyms
Immunoglobulin heavy constant gamma 2; IGHG2; Ig gamma-2 chain C region; IgG2 Fc
AA Sequence

ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGMEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Weight

Approximately 32 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IgG2 Fc Protein, Human (V161M, S257A, HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IgG2 Fc Protein, Human (V161M, S257A, HEK293)
Cat. No.:
HY-P72605
Quantity:
MCE Japan Authorized Agent: