IgG2A Fc Protein, Mouse (HEK293)

Ig gamma-2A chain C region (Immunoglobulin heavy chain gamma polypeptide) is one of the five types of mammalian immunoglobulin heavy chain: γ, δ, α, μ and ε. Heavy chain γ defines the classes of immunoglobulins IgG^[1]. IgG2A Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2A Fc protein, expressed by HEK293 , with tag free. The total length of IgG2A Fc Protein, Mouse (HEK293) is 232 a.a., with molecular weight of 30-35 kDa.

Ig gamma-2A chain C region (Immunoglobulin heavy chain gamma polypeptide) is one of the five types of mammalian immunoglobulin heavy chain: γ, δ, α, μ and ε. Heavy chain γ defines the classes of immunoglobulins IgG^[1].

Mouse

HEK293

Tag Free

P01863 (P99-K330)

380793

PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

30-35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.