IgG2B Fc Protein, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells^[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free. The total length of IgG2B Fc Protein, Mouse (HEK293) is 239 a.a., with molecular weight of 30-32 kDa.

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells^[1]. In wake of cutting by pepsin, IgG is divided into two F(ab)s with one antigen binding site and a high conserved Fc segment^[2][3]. The Fc segment bears a highly conserved N-glycosylation site. There are two members of IgG2: IgG2a and IgG2b. It was found that IgG2a was superior to IgG1 in activating complement^[4]. The glycosylation of the circulating immunoglobulin-γ (IgG) antibody molecules changes in rheumatoid arthritis. Ig gamma-2 chain Fc region contains two constant regions of IgG2 H chain (CH2, CH3)^[5].

Mouse

HEK293

Tag Free

P01867-2 (E97-K335)

16016  [NCBI]

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

31-37 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.