IgG1 Protein, Mouse (HEK293)

The immunoglobulin heavy chain constant region is the heavy chain constant region of immunoglobulin. Sequence differences between immunoglobulin heavy chains leads to the various isotypes with different characteristic^[1][2]. IgG1 Protein, Mouse (HEK293) is the recombinant mouse-derived IgG1 protein, expressed by HEK293 , with tag free. The total length of IgG1 Protein, Mouse (HEK293) is 226 a.a., with molecular weight of ~30.0 kDa.

The immunoglobulin heavy chain constant region is the heavy chain constant region of immunoglobulin. Sequence differences between immunoglobulin heavy chains leads to the various isotypes with different characteristic. The immunoglobulin heavy chain constant region affects kinetic and Tthermodynamic parameters of antibody variable region interactions with antigen^[1][2].

Mouse

HEK293

Tag Free

AAK53870.1 (P99-K324)

/

PRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.