1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Immunoglobulin Superfamily Member 11 (IGSF11)
  6. IGSF11 Protein, Human (HEK293, Fc)

IGSF11 Protein, Human (HEK293, Fc)

Cat. No.: HY-P70854
COA Handling Instructions

IGSF11 Protein functions as a cell adhesion molecule, facilitating cellular adhesion through homophilic interactions. It also stimulates cell growth, suggesting its role in regulating cellular proliferation. IGSF11 Protein, Human (HEK293, Fc) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $125 In-stock
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGSF11 Protein functions as a cell adhesion molecule, facilitating cellular adhesion through homophilic interactions. It also stimulates cell growth, suggesting its role in regulating cellular proliferation. IGSF11 Protein, Human (HEK293, Fc) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

IGSF11 Protein serves as a cell adhesion molecule by engaging in homophilic interactions, facilitating cellular adhesion processes. Additionally, it plays a role in stimulating cell growth, implying its involvement in the regulation of cellular proliferation.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q5DX21-1 (L23-G245)

Gene ID
Molecular Construction
N-term
IGSF11 (L23-G245)
Accession # Q5DX21-1
hFc
C-term
Synonyms
BT-IgSF; CT119; CXADRL1; Igsf13; VSIG3
AA Sequence

LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAG

Molecular Weight

57-70 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGSF11 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70854
Quantity:
MCE Japan Authorized Agent: