1. Recombinant Proteins
  2. Others
  3. IHH Protein, Human

IHH Protein, Human is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IHH Protein, Human is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification.

Background

Indian hedgehog (Ihh), which encodes amember of the Hedgehog family of signaling factors, is initially expressed in chondrocytes of the early cartilaginous skeletal elements[1]. Indian Hedgehog is an antagonist of Wnt signaling in colonic epithelial cell differentiation[2]. Ihh is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification. It regulates its effects by feedback control of parathyroid hormone-related peptide (PTHrP) [3].

Biological Activity

1.The ED50 is <3 μg/mL as measured by its ability to induce alkaline phosphatase production by CCL-226 cells.
2.Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 fibroblasts. The ED50 for this effect is typically 5.587 μg/mL, corresponding to a specific activity is 179.0 units/mg.

  • Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 fibroblasts. The ED50 for this effect is typically 5.587 μg/mL, corresponding to a specific activity is 179.0 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q14623 (G29-G202)

Gene ID
Molecular Construction
N-term
IHH (G29-G202)
Accession # Q14623
C-term
Synonyms
rHuIHH; HHG-2
AA Sequence

GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG

Molecular Weight

Approximately 20 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IHH Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IHH Protein, Human
Cat. No.:
HY-P7204
Quantity:
MCE Japan Authorized Agent: