IL-10 Protein, Virus

IL-10 Protein critically masks infected cells for immune evasion by down-regulating the host TAP1 gene, hindering peptide transport into the endoplasmic reticulum and loading onto MHC class I molecules. IL-10 also inhibits IFN-gamma synthesis and exists as a homodimer. IL-10 Protein, Virus is the recombinant Virus-derived IL-10 protein, expressed by E. coli , with tag free.

The IL-10 protein plays a critical role in immune recognition by cytotoxic T-lymphocytes, as it is involved in masking infected cells. It accomplishes this by down-regulating the expression of the host TAP1 gene, which hampers the transport of peptides into the endoplasmic reticulum and their subsequent loading onto MHC class I molecules. Additionally, IL-10 inhibits the synthesis of IFN-gamma. It exists as a homodimer.

Measured by its ability to inhibit LPS-induced IL-1 beta secretion by THP-1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 0.5804 ng/mL.

Virus

E. coli

Tag Free

P03180 (Q26-R170)

2949786  [NCBI]

QCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR

Approximately 17.2 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 10 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.