IL-12R beta 1 Protein, Human (HEK293, His)

IL-12R beta 1 protein is an IL-12 cytokine surface receptor that activates the Jak-Stat signaling cascade pathway and is involved in IL-12-mediated immune regulation. IL-12R beta 1 Protein, Human (HEK293, His) is expressed by HEK293 cells with a C-terminal 6*His tag^[1].

The IL-12 receptor is a type I cytokine receptor that binds to IL-12. It is expressed primarily on NK and T cells and consists of beta 1 and beta 2 subunits and is a member of the gp130 cytokine receptor superfamily. IL-12R beta 1 (abbreviated IL-12R1 or IL-12Rβ1) is a subunit of the IL-12 receptor. IL-12R beta 1, also known as CD212 (cluster of differentiation 212), is the name of its human gene. It encodes a type I transmembrane protein belonging to the hematopoietin receptor superfamily. IL-12Rβ1 can form disulfide-linked oligomers, which are required for IL-12 binding activity, and binds to IL-12 with low affinity. In parallel, IL-12Rβ1 protein can be co-expressed with IL-12Rβ2 protein, leading to the formation of high-affinity IL-12 binding sites and the reconstitution of IL-12-dependent signaling^[1].
Upon IL-12 binding to the IL-12 receptor, the cytoplasmic protein TYK2, which interacts directly with IL-12Rβ1, and JAK2, which interacts with IL-12Rβ2, are tyrosine phosphorylated. Phosphorylated TYK2 and JAK2 are required for subsequent tyrosine phosphorylation and activation of STAT4, which binds to IL-12Rβ2. STAT4 is a transcription factor that subsequently homodimerizes, translocates to the nucleus and binds to its target DNA to activate transcription of IFN-γ and other target genes. IL-12Rβ1 also binds to IL23R to form the IL-23 receptor, which is involved in IL-23 signaling. It plays a role in IL-23 signaling, possibly through activation of the Jak-Stat signaling cascade. IL-12Rβ1 is expressed in a low intensity constitutive phenotype on the surface of lymphocytes and can be highly upregulated by T cell activation or by stimulation with various interleukins such as IL-2, IL-7 and IL-15. It is also expressed on dendritic cells. Lack of expression of this gene leads to immunodeficiency in patients with severe Mycobacterium and Salmonella infections^[2].

IL-12Rβ1-deficient patients are able to develop Th1 T cells, and most Th1 T cell clones (TCCs) are able to respond specifically and consistently to IL-12 by increasing IFN-γ production^[1].
IL-12Rβ1 can be expressed on human monocyte-derived dendritic cells (DCs) as well as T cells (TCs) and Con A parent cells, and IL-12Rβ1 is expressed at higher levels on monocyte-derived DCs than on TCs and Con A parent cells. In contrast, little or no IL-12Rβ1 expression is observed in monocytes. IL-12Rβ1 binding to IL-12 induces tyrosine phosphorylation of a variety of intracellular proteins in DCs^[3].

Human

HEK293

C-6*His

P42701-1 (C24-E540)

3594  [NCBI]

CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE

80-110 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. C E Verhagen, et al. Residual type 1 immunity in patients genetically deficient for interleukin 12 receptor beta1 (IL-12Rbeta1): evidence for an IL-12Rbeta1-independent pathway of IL-12 responsiveness in human T cells. J Exp Med. 2000 Aug 21;192(4):517-28.  [Content Brief]

  [2]. Esther van de Vosse, et al. IL-12Rβ1 deficiency: mutation update and description of the IL12RB1 variation database. Hum Mutat. 2013 Oct;34(10):1329-39.  [Content Brief]

  [3]. H Nagayama, et al. IL-12 responsiveness and expression of IL-12 receptor in human peripheral blood monocyte-derived dendritic cells. J Immunol. 2000 Jul 1;165(1):59-66.  [Content Brief]