IL-13 Protein, Cynomolgus (HEK293)

IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with tag free. The total length of IL-13 Protein, Cynomolgus (HEK293) is 112 a.a., with molecular weight of ~12.3 kDa.

Interleukin-13 (IL-13), a pivotal cytokine, assumes crucial roles in allergic inflammation and the immune response to parasite infection. Operating synergistically with IL2, it regulates interferon-gamma synthesis and stimulates B-cell proliferation, as well as the activation of eosinophils, basophils, and mast cells. IL-13 plays a pivotal role in controlling IL33 activity by modulating the production of transmembrane and soluble forms of interleukin-1 receptor-like 1/IL1RL1. Notably, it exhibits the capacity to antagonize Th1-driven proinflammatory immune responses, downregulating the synthesis of various proinflammatory cytokines, including IL1, IL6, IL10, IL12, and TNF-alpha, through a mechanism that involves partial suppression of NF-kappa-B. Moreover, IL-13 functions on nonhematopoietic cells, such as endothelial cells, inducing vascular cell adhesion protein 1/VCAM1, which is crucial for eosinophil recruitment. The biological effects of IL-13 are mediated through its receptors, comprising the IL4R chain and the IL13RA1 chain, activating JAK1 and TYK2, ultimately leading to STAT6 activation. Additionally, another receptor, IL13RA2, acts as a high-affinity decoy for IL-13, mediating internalization and depletion of extracellular IL-13. The cytokine interacts with IL13RA2, further adding to its intricate regulatory network^{[1][2][3][4][5]}.

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells and the ED₅₀ is typically 1-8 ng/mL.

Cynomolgus

HEK293

Tag Free

ABG75889.1 (S21-N132)

102125887  [NCBI]

SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN

Approximately 12.3 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.