IL-13 Protein, Human (HEK293, mFc)

IL-13 Protein, Human (HEK 293, mFc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK 293, mFc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the mFc tag.

Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. Interleukin- 13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation, Ig class switching to IgE synthesis, and enhanced production of IgG4 and IgM. In human macrophages and monocytes,hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent^[1].

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells The ED₅₀ for this effect is 349.05 ng/mL.

Human

HEK293

C-mFc

AAK53823.1 (G21-N132)

3596  [NCBI]

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

38-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12(2):239-48.  [Content Brief]