1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-13 Receptor
  5. IL-13Rα2
  6. IL-13R alpha 2 Protein, Rat (HEK293, His)

IL-13R alpha 2 Protein, functioning as a monomer, exhibits strong affinity for binding to interleukin-13 (IL-13), thereby playing a crucial role in mediating the biological effects of IL-13 and regulating various cellular processes. IL-13R alpha 2 Protein, Rat (HEK293, His) is the recombinant rat-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag. The total length of IL-13R alpha 2 Protein, Rat (HEK293, His) is 313 a.a., with molecular weight of ~43-55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-13R alpha 2 Protein, functioning as a monomer, exhibits strong affinity for binding to interleukin-13 (IL-13), thereby playing a crucial role in mediating the biological effects of IL-13 and regulating various cellular processes. IL-13R alpha 2 Protein, Rat (HEK293, His) is the recombinant rat-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag. The total length of IL-13R alpha 2 Protein, Rat (HEK293, His) is 313 a.a., with molecular weight of ~43-55 kDa.

Background

The IL-13R alpha 2 protein, as a monomer, demonstrates a high affinity for binding to interleukin-13 (IL-13). This interaction plays a crucial role in mediating the biological effects of IL-13 and contributes to the regulation of various cellular processes.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q8VHK6 (L24-K336)

Gene ID
Molecular Construction
N-term
IL-13Rα2 (L24-K336)
Accession # Q8VHK6
His
C-term
Synonyms
Interleukin-13 receptor subunit alpha-2; IL-13R-alpha-2; IL-13RA2; CD213a2; IL13RA2; IL13R
AA Sequence

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVMDNFKECKLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWTEASYGIADEGSLGTKIQDMKCIYYNWQYLVCSWKPGKTVHSDTNYTMFFWYEGLDHALQCADYLQDNEKNVGCKLSNLDSSDYKDFFIRVNGSSKLEPIRSSYMVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPSCYTYEIVVREDDISWESATDKNDMKLKRRANESEDLCFFVRCKINIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Weight

Approximately 43-55 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-13R alpha 2 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-13R alpha 2 Protein, Rat (HEK293, His)
Cat. No.:
HY-P75834
Quantity:
MCE Japan Authorized Agent: