IL-15 Protein, Human (His)

IL-15 Protein, Human (His) is a cytokine for immune cell stimulation, increases the proliferation and persistence of natural killer (NK) and T cells.

Interleukin-15 is a highly attractive cytokine for immune cell stimulation because it can increase the proliferation and persistence of natural killer (NK) and T cells^[1].

1.The ED₅₀ is <0.5 ng/mL as measured by CTL-2 cells, corresponding to a specific activity of >2 × 10⁶ units/mg.
2.Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED₅₀ for this effect is 2.380 ng/mL, corresponding to a specific activity is 4.202×1010⁵ units/mg.

Human

E. coli

N-His

P40933-1 (N49-S162)

3600  [NCBI]

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Approximately 13.6 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Van Audenaerde JRM, et al. Interleukin-15 stimulates natural killer cell-mediated killing of both human pancreatic cancer and stellate cells. Oncotarget. 2017 May 25;8(34):56968-56979.  [Content Brief]