IL-15 Protein, Human

IL-15 Protein, Human is a pleiotropic cytokine, including T, B and NK cell-stimulatory activities.

Interleukin 15 is a cytokine that shares many biological properties with IL-2, including T, B and NK cell-stimulatory activities. Interleukin-15 has significant potential in cancer immunotherapy as an activator of antitumor CD8 T and natural killer (NK) cells^[1]. Interleukin-15 (IL-15) is a pleiotropic cytokine and a member of the four α-helix bundle family of cytokines which include IL-2, IL-4, IL-7, IL-9, IL-15 and IL-21. IL-15 exhibits a broad biological activity and induces the differentiation and proliferation of T, B and natural killer (NK) cells. As a potent pro-inflammatory cytokine, IL-15 plays an important and complex role in autoimmune disease and inflammation. IL-15 plays a pivotal role in some hematological malignancies and presents anti-tumor effects. The direct administration of IL-15 has shown anti-tumor effects in several preclinical mouse tumor models^[2].

1. The ED₅₀ is <0.5 ng/mL as measured by CTLL-2 cells, corresponding to a specific activity of >2 × 10⁶ units/mg.
2.The ED₅₀ is less than 2 ng/mL, as measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells.

• 
  The ED₅₀ is 2 ng/mL, as measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells.

Human

E. coli

Tag Free

P40933-1 (N49-S162)

3600  [NCBI]

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Approximately 12.8 kD

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS or 20 mM PB, 150 mM NaCl, pH 7.0 or PBS, pH 7.4, 8% trehalose..

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Conlon KC, et al. Redistribution, hyperproliferation, activation of natural killer cells and CD8 T cells, and cytokine production during first-in-human clinical trial of recombinant human interleukin-15 in patients with cancer. J Clin Oncol. 2015 Jan 1;33(1):74-82.  [Content Brief]

  [2]. Sun W, et al. High level expression and purification of active recombinant human interleukin-15 in Pichiapastoris. J Immunol Methods. 2016 Jan;428:50-7.  [Content Brief]