1. Recombinant Proteins
  2. Others
  3. IL-17A Protein, Rat (CHO)

The IL-17A protein has important heterodimerization and homodimerization activities and is involved in a variety of processes, including responses to glucocorticoid stimulation and the regulation of cell death and transcription. IL-17A is present in the cytoplasm and extracellular space and has been implicated in diseases such as pancreatitis, inflammatory bowel disease, renal disease, and periodontal disease, and may serve as a biomarker. IL-17A Protein, Rat (CHO) is the recombinant rat-derived IL-17A protein, expressed by CHO , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
200 μg In-stock
> 200 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-17A Protein, Rat (CHO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-17A protein has important heterodimerization and homodimerization activities and is involved in a variety of processes, including responses to glucocorticoid stimulation and the regulation of cell death and transcription. IL-17A is present in the cytoplasm and extracellular space and has been implicated in diseases such as pancreatitis, inflammatory bowel disease, renal disease, and periodontal disease, and may serve as a biomarker. IL-17A Protein, Rat (CHO) is the recombinant rat-derived IL-17A protein, expressed by CHO , with tag free.

Background

IL-17A Protein is predicted to play a crucial role in protein heterodimerization and homodimerization activities. It is involved in various biological processes, including the cellular response to glucocorticoid stimulus, positive regulation of necrotic cell death, and positive regulation of transcription by RNA polymerase II. This protein is found in both the cytoplasm and extracellular space. IL-17A is implicated in numerous diseases, including acute necrotizing pancreatitis, inflammatory bowel disease, lipoid nephrosis, lung diseases, and periodontal diseases, serving as a biomarker for these conditions. It is also associated with specific ailments such as anti-basement membrane glomerulonephritis, congestive heart failure, myocarditis, pleurisy, and uveitis. Furthermore, IL-17A's human ortholog, interleukin 17A, is linked to diseases like Mycobacterium avium complex disease, autoimmune diseases, bronchial diseases, macular degeneration, and rhinitis. Despite its low expression in the reference dataset, IL-17A remains a key player in immune response and disease pathology.

Biological Activity

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.189 ng/mL, corresponding to a specific activity is 8.41×105 U/mg.

  • Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is <7 ng/mL, corresponding to a specific activity is >1.43×105 U/mg.
Species

Rat

Source

CHO

Tag

Tag Free

Accession

G3V7M4/NP_001100367 (A26-S158)

Gene ID
Molecular Construction
N-term
IL-17A (A26-S158)
Accession # G3V7M4/NP_001100367
C-term
Synonyms
Il17a; interleukin 17A; Il17; IL-17; CTLA-8; IL-17A; interleukin-17A; Interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); cytotoxic T-lymphocyte-associated antigen 8; Interleukin 17
AA Sequence

AVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS

Molecular Weight

13-22 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-17A Protein, Rat (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17A Protein, Rat (CHO)
Cat. No.:
HY-P79326
Quantity:
MCE Japan Authorized Agent: