IL-17A Protein, Rat (CHO)

The IL-17A protein has important heterodimerization and homodimerization activities and is involved in a variety of processes, including responses to glucocorticoid stimulation and the regulation of cell death and transcription. IL-17A is present in the cytoplasm and extracellular space and has been implicated in diseases such as pancreatitis, inflammatory bowel disease, renal disease, and periodontal disease, and may serve as a biomarker. IL-17A Protein, Rat (CHO) is the recombinant rat-derived IL-17A protein, expressed by CHO , with tag free.

IL-17A Protein is predicted to play a crucial role in protein heterodimerization and homodimerization activities. It is involved in various biological processes, including the cellular response to glucocorticoid stimulus, positive regulation of necrotic cell death, and positive regulation of transcription by RNA polymerase II. This protein is found in both the cytoplasm and extracellular space. IL-17A is implicated in numerous diseases, including acute necrotizing pancreatitis, inflammatory bowel disease, lipoid nephrosis, lung diseases, and periodontal diseases, serving as a biomarker for these conditions. It is also associated with specific ailments such as anti-basement membrane glomerulonephritis, congestive heart failure, myocarditis, pleurisy, and uveitis. Furthermore, IL-17A's human ortholog, interleukin 17A, is linked to diseases like Mycobacterium avium complex disease, autoimmune diseases, bronchial diseases, macular degeneration, and rhinitis. Despite its low expression in the reference dataset, IL-17A remains a key player in immune response and disease pathology.

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is <7 ng/mL, corresponding to a specific activity is >1.43×10⁵ U/mg.

• 
  Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is <7 ng/mL, corresponding to a specific activity is >1.43×10⁵ U/mg.

Rat

CHO

Tag Free

G3V7M4/NP_001100367 (A26-S158)

301289  [NCBI]

AVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS

13-22 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.