IL-18BP Protein, Mouse (HEK293, Fc)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IL-18BP Protein, Mouse (HEK293, Fc) is 165 a.a., with molecular weight of 60-90 kDa.

The IL-18BP protein serves as a key regulator by binding to interleukin-18 (IL-18) and effectively inhibiting its activity. Through this interaction, IL-18BP functions as an inhibitor of the early TH1 cytokine response, highlighting its role in modulating immune processes and potentially contributing to the regulation of inflammatory responses.

Mouse

HEK293

C-hFc

Q9Z0M9 (T29-A193)

16068  [NCBI]

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

60-90 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.