1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-21
  5. IL-21 Protein, Mouse (122a.a)

IL-21 Protein, Mouse (122a.a)

Cat. No.: HY-P70643
SDS COA Handling Instructions

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG(1) and IgG(3) by B cells, thereby forming a humoral immune response. IL-21 Protein, Mouse (122a.a) is the recombinant mouse-derived IL-21 protein, expressed by E. coli , with tag free. The total length of IL-21 Protein, Mouse (122a.a) is 122 a.a., with molecular weight of ~16.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $150 In-stock
50 μg $420 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG(1) and IgG(3) by B cells, thereby forming a humoral immune response. IL-21 Protein, Mouse (122a.a) is the recombinant mouse-derived IL-21 protein, expressed by E. coli , with tag free. The total length of IL-21 Protein, Mouse (122a.a) is 122 a.a., with molecular weight of ~16.0 kDa.

Background

IL-21, a cytokine endowed with immunoregulatory prowess, emerges as a key player in orchestrating the delicate transition between innate and adaptive immunity. This multifaceted regulator takes the stage in inducing the production of IgG(1) and IgG(3) in B-cells, thereby substantiating its pivotal role in shaping humoral immune responses. IL-21 finds its niche in fostering the generation and perpetuation of T follicular helper (Tfh) cells and the intricate formation of germinal centers. Collaborating synergistically with IL6, it exercises command over the early development of Tfh cells, contributing indispensably to a robust antibody response during acute viral infections. Beyond B-cells, IL-21 extends its influence to the realm of natural killer (NK) cells, where, in synergy with IL15, it fuels their proliferation and maturation. Further, IL-21 flexes its regulatory muscle, guiding the proliferation and maturation of mature B- and T-cells in response to activating stimuli. In tandem with IL15 and IL18, it orchestrates the production of interferon-gamma in both T-cells and NK cells. Notably, during T-cell-mediated immune responses, IL-21 steps in as a potential inhibitor, dampening the activation and maturation of dendritic cells, unveiling a nuanced regulatory role in immune dynamics.

Biological Activity

Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 for this effect is 7.286 ng/mL, corresponding to a specific activity is 1.372×105 U/mg.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q9ES17 (P25-S146)

Gene ID
Molecular Construction
N-term
IL-21 (P25-S146)
Accession # Q9ES17
C-term
Synonyms
Interleukin-21; Il21
AA Sequence

PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

IL-21 Protein, Mouse (122a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-21 Protein, Mouse (122a.a)
Cat. No.:
HY-P70643
Quantity:
MCE Japan Authorized Agent: