IL-21 Protein, Mouse (129a.a)

IL-21 Protein, Mouse (129a.a) is a regulatory cytokine thought to play a role in the transition between innate and adaptive immunity.

Interleukin 21 (IL-21) is a novel type I cytokine that is significantly homologous to IL-2, IL-4 and IL-15. Its receptor complex contains gammac chain which is also a component of receptors for IL-2, IL-4, IL-7, IL-9 and IL-15, so there may be overlapping or relevancies in their biological functions. IL-21 is capable of co-stimulating mature T cells, B cells, NK cells, and of stimulating CD16 expression on the surface of NK cells to induce ADCC in innate immune response. It can also strengthen the anti-tumor effect of the cellular immunity, especially via enhancing the activities of NK and antigen specific CTL cells. Thus, IL-21 is a potential useful therapeutic molecule for immunotherapy of malignancies, by eliciting innate and adaptive anti-tumor responses in tumor-bearing hosts^[1]

1.The ED₅₀ is <1 ng/mL as measured by human ANBL-6 cells, corresponding to a specific activity of >1.0 × 10⁶ units/mg.
2.Measured by its binding ability in a functional ELISA. When Mouse IL-21 is coated at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-21R. The ED₅₀ for this effect is 17.34 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Mouse IL-21 is coated at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-21R .The ED₅₀ for this effect is 17.34 ng/mL.

Mouse

E. coli

Tag Free

Q9ES17 (H18-S146)

60505  [NCBI]

HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Approximately 15.1 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Tang W, et al. Expression, purification and identification of recombinant mouse interleukin 21 protein in E. coli. Cell Mol Immunol. 2006 Aug;3(4):311-5.  [Content Brief]