1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-21
  5. IL-21 Protein, Rat

IL-21 Protein, crucial in immune responses and lymphocyte activation, exhibits biased expression in tissues like the thymus and spleen. Predicted to be active in the extracellular space, it serves as a biomarker for periodontal disease and is implicated in conditions like asthma, hepatocellular carcinoma, and systemic lupus erythematosus. IL-21 Protein, Rat is the recombinant rat-derived IL-21 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-21 Protein, crucial in immune responses and lymphocyte activation, exhibits biased expression in tissues like the thymus and spleen. Predicted to be active in the extracellular space, it serves as a biomarker for periodontal disease and is implicated in conditions like asthma, hepatocellular carcinoma, and systemic lupus erythematosus. IL-21 Protein, Rat is the recombinant rat-derived IL-21 protein, expressed by E. coli , with tag free.

Background

IL-21 Protein is predicted to possess interleukin-2 receptor binding activity and is anticipated to be involved in various processes, including lymphocyte activation in immune responses, positive regulation of immune effector processes, and tyrosine phosphorylation of STAT protein. Additionally, IL-21 is predicted to act upstream of or within processes such as positive regulation of cytokine production, positive regulation of lymphocyte activation, and positive regulation of tyrosine phosphorylation of STAT protein. The protein is expected to be located in the extracellular space. IL-21 serves as a biomarker for periodontal disease and is implicated in various human conditions, including asthma, common variable immunodeficiency, hepatocellular carcinoma, and systemic lupus erythematosus. Notably, IL-21 exhibits biased expression in tissues such as the thymus and spleen, indicating its potential role in immune regulation within these organs.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat IL-21 at 5 μg/mL (100 μL/well) can bind Biotinylated Rat IL-21R Protein. The ED50 for this effect is 12.16 ng/mL.

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

A3QPB9/NP_001102413.1 (P25-S146)

Gene ID
Molecular Construction
N-term
IL-21 (P25-S146)
Accession # A3QPB9/NP_001102413.1
C-term
Synonyms
Interleukin-21; Il21; Za11
AA Sequence

PDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS

Molecular Weight

Approximately 16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-21 Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-21 Protein, Rat
Cat. No.:
HY-P74818
Quantity:
MCE Japan Authorized Agent: