1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-22BP
  5. IL-22BP/IL-22RA2 Protein, Human (HEK293, His)

IL-22BP/IL-22RA2 proteins (especially isoform 2) act as IL22 receptors and antagonists, inhibiting IL22 activity by preventing its interaction with functional IL-22R complexes in vitro. This regulatory effect suggests its potential in modulating inflammatory responses. IL-22BP/IL-22RA2 Protein, Human (HEK293, His) is the recombinant human-derived IL-22BP/IL-22RA2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-22BP/IL-22RA2 proteins (especially isoform 2) act as IL22 receptors and antagonists, inhibiting IL22 activity by preventing its interaction with functional IL-22R complexes in vitro. This regulatory effect suggests its potential in modulating inflammatory responses. IL-22BP/IL-22RA2 Protein, Human (HEK293, His) is the recombinant human-derived IL-22BP/IL-22RA2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

IL-22BP, specifically Isoform 2, serves as a receptor for IL22. This isoform not only binds to IL22 but also acts as an antagonist by preventing the interaction between IL22 and the functional IL-22R complex, consequently inhibiting the activity of IL22 in vitro. The regulatory function of Isoform 2 suggests its potential involvement in modulating inflammatory responses. On the other hand, Isoform 1 is implicated in processes related to establishing and maintaining successful pregnancy, indicating a distinct role in reproductive physiology. The dual roles of IL-22BP isoforms highlight their versatility in influencing both inflammatory pathways and reproductive outcomes.

Biological Activity

Measured by its ability to inhibit IL-22-induced IL-10 secretion by COLO 205 human colorectal adenocarcinoma cells. The ED50 for this effect is 1.736 ng/mL in the presence of 1 ng/mL of Human IL-22, corresponding to a specific activity is 5.76×105 U/mg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q969J5-2 (T22-P231)

Gene ID
Synonyms
Interleukin-22 receptor subunit alpha-2; IL-22RA2; CRF2-10; CRF2-S1; IL-22BP; ZcytoR16
AA Sequence

TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP

Molecular Weight

Approximately 40-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-22BP/IL-22RA2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-22BP/IL-22RA2 Protein, Human (HEK293, His)
Cat. No.:
HY-P72557
Quantity:
MCE Japan Authorized Agent: