IL-22R alpha 1 Protein, Mouse (HEK293, Fc)

IL-22R α 1 and IL-10R β together form IL20, IL22 and IL24 receptor complexes, activating different signaling pathways. Within the IL22 receptor, IL-22R α 1 binds to IL10RB and mediates IL22 signaling through the JAK/STAT and MAPK1/MAPK3/Akt pathways. IL-22R alpha 1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-22R alpha 1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IL-22R alpha 1 Protein, Mouse (HEK293, Fc) is 213 a.a., with molecular weight of 65-68 kDa.

IL-22R alpha 1, a key component of the receptor for IL20, IL22, and IL24, plays a crucial role in mediating the signaling pathways activated by these interleukins. It forms a heterodimer with IL10RB, constituting the IL22 receptor and facilitating IL22 signaling via JAK/STAT pathways. IL-22R alpha 1 is also part of another receptor complex, along with IL20RB, responding to IL20 and IL24, leading to the activation of STATs. Beyond JAK/STAT pathways, IL-22 induces MAPK1/MAPK3 and Akt kinases activation. Notably, IL-22R alpha 1 contributes to the antiangiogenic activity of IL24 and inhibits endothelial cell tube formation and differentiation induced by IL24. In its functional heterodimeric associations with IL10RB and IL20RB, IL-22R alpha 1 underscores its pivotal role in mediating the diverse cellular responses to IL20, IL22, and IL24.

Immobilized Biotinylated Mouse IL-22, His Tag at 2μg/ml (100μl/well) on the streptavidin precoated plate (5μg/ml). Dose response curve for Mouse IL-22R alpha 1, hFc Tag with the EC₅₀ of 15.2 ng/ml determined by ELISA.

Mouse

HEK293

C-hFc

Q80XZ4 (H16-A228)

230828  [NCBI]

HTTVDTSGLLQHVKFQSSNFENILTWDGGPASTSDTVYSVEYKKYGERKWLAKAGCQRITQKFCNLTMETRNHTEFYYAKVTAVSAGGPPVTKMTDRFSSLQHTTIKPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLELHVNHTYQMHLEGKQREYEFLGLTPDTEFLGSITILTPILSKESAPYVCRVKTLPDRTWA

65-68 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.