1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-22 Receptor
  5. IL-22R alpha 1
  6. IL-22R alpha 1 Protein, Mouse (HEK293, Fc)

IL-22R α 1 and IL-10R β together form IL20, IL22 and IL24 receptor complexes, activating different signaling pathways. Within the IL22 receptor, IL-22R α 1 binds to IL10RB and mediates IL22 signaling through the JAK/STAT and MAPK1/MAPK3/Akt pathways. IL-22R alpha 1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-22R alpha 1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IL-22R alpha 1 Protein, Mouse (HEK293, Fc) is 213 a.a., with molecular weight of 65-68 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-22R alpha 1 Protein, Mouse (HEK293, Fc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-22R α 1 and IL-10R β together form IL20, IL22 and IL24 receptor complexes, activating different signaling pathways. Within the IL22 receptor, IL-22R α 1 binds to IL10RB and mediates IL22 signaling through the JAK/STAT and MAPK1/MAPK3/Akt pathways. IL-22R alpha 1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-22R alpha 1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IL-22R alpha 1 Protein, Mouse (HEK293, Fc) is 213 a.a., with molecular weight of 65-68 kDa.

Background

IL-22R alpha 1, a key component of the receptor for IL20, IL22, and IL24, plays a crucial role in mediating the signaling pathways activated by these interleukins. It forms a heterodimer with IL10RB, constituting the IL22 receptor and facilitating IL22 signaling via JAK/STAT pathways. IL-22R alpha 1 is also part of another receptor complex, along with IL20RB, responding to IL20 and IL24, leading to the activation of STATs. Beyond JAK/STAT pathways, IL-22 induces MAPK1/MAPK3 and Akt kinases activation. Notably, IL-22R alpha 1 contributes to the antiangiogenic activity of IL24 and inhibits endothelial cell tube formation and differentiation induced by IL24. In its functional heterodimeric associations with IL10RB and IL20RB, IL-22R alpha 1 underscores its pivotal role in mediating the diverse cellular responses to IL20, IL22, and IL24.

Biological Activity

Immobilized Biotinylated Mouse IL-22, His Tag at 2μg/ml (100μl/well) on the streptavidin precoated plate (5μg/ml). Dose response curve for Mouse IL-22R alpha 1, hFc Tag with the EC50 of 15.2 ng/ml determined by ELISA.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q80XZ4 (H16-A228)

Gene ID
Molecular Construction
N-term
IL-22Rα 1 (H16-A228)
Accession # Q80XZ4
hFc
C-term
Synonyms
IL-22R-alpha-1; IL-22RA1; CRF2-9; IL22R; IL22R1; IL-TIF-R1; zcytoR11
AA Sequence

HTTVDTSGLLQHVKFQSSNFENILTWDGGPASTSDTVYSVEYKKYGERKWLAKAGCQRITQKFCNLTMETRNHTEFYYAKVTAVSAGGPPVTKMTDRFSSLQHTTIKPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLELHVNHTYQMHLEGKQREYEFLGLTPDTEFLGSITILTPILSKESAPYVCRVKTLPDRTWA

Molecular Weight

65-68 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-22R alpha 1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77969
Quantity:
MCE Japan Authorized Agent: