1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. Interleukin & Receptors NK Cell CD Proteins
  4. IL-2 Receptor IL-2R gamma/Common gamma-Chain/CD132
  5. IL-2R gamma/Common gamma-Chain/CD132
  6. IL-2R gamma/CD132 Protein, Human (HEK293, His)

IL-2R gamma/CD132 Protein, Human (HEK293, His)

Cat. No.: HY-P70556
Data Sheet Handling Instructions Technical Support

IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types. IL-2R gamma/CD132 Protein, Human (HEK293, His) is a recombinant human extracellular region of IL-2R gamma (L23-A262) with a C-Terminal 6*His tag, which is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2[1]. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[2]. IL-2R gamma/CD132 Protein, Human (HEK293, His) is a recombinant human extracellular region of IL-2R gamma (L23-A262) with a C-Terminal 6*His tag, which is produced in HEK293 cells.

Background

IL-2R gamma (CD132), a receptor for IL-2, is a member of the type I cytokine receptor family and type 5 subfamily. IL-2R gamma is expressed in leucocyte subsets and human monocytes[1][3]. Human IL-2R gamma consists of extracellular domain (L23-A262), helical domain (V263-L283), and cytoplasmic domain (E284-T369).
The sequence of amino acids in IL-2R beta differs in different species. Human IL-2R gamma shares <75% aa sequence identity with mouse and rats.
IL-2R gamma has low-affinity for IL-2, but has intermediate affinity for IL-2 when forming heterodimer with IL-2R beta. IL-2R beta/gama heterodimer complex transduces a signal when IL-2 concentrations are relatively high[1]. IL-2R gamma can be utilized by the IL-2, IL-4, IL-7, IL-9, and IL-15 receptor, and takes part in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[2]. IL-2R gamma is tightly up-regulated by IL-2 and IFN gamma[3]. Mutations of L-2R gamm cause human X-linked severe combined immunodeficiency (XSCID)[4].
IL-2R gamma is involved in inflammatory response, and mediates activation of the cells[1].

In Vitro

IL-2R gamma (human) migrates with a molecular weight corresponding to 55–60 kDa (immunoblotting of lysates prepared from Sf9 cells infected with VL1392-hIL-2Rγ)[5].
IL-2R gamma binds to IL-2 in recombinant IL-2R gamma plasmid (pGEX-4T-1-IL-2Rγ)-transfected 293T cells[6].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P31785-1 (L23-A262)

Gene ID
Molecular Construction
N-term
IL-2R gamma/CD132 (L23-A262)
Accession # P31785-1
6*His
C-term
Synonyms
IL-2RG; IL-2 R gamma; IL-2Rγ; IL2R γ; Cytokine receptor common subunit gamma; Interleukin-2 receptor subunit gamma; gammaC; P64; CD132 and IL2RG
AA Sequence

LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEA

Molecular Weight

45-85 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

IL-2R gamma/CD132 Protein, Human (HEK293, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-2R gamma/CD132 Protein, Human (HEK293, His)
Cat. No.:
HY-P70556
Quantity:
MCE Japan Authorized Agent: