IL-3 Protein, Canine

IL-3 Protein, Canine is a hemopoietic growth factor involved in the survival, proliferation and differentiation of multipotent hemopoietic cells.

Interleukin-3 (IL-3) is a multipotent hematopoietic growth factor produced by activated T cells, monocytes/macrophages and stroma cells. Addition of IL-3 to the culture medium induces proliferation, maturation and probably self-renewal of pluripotent hematopoietic stem cells and cells of myeloid, erythroid and megakaryocytic lineages^[1]. IL-3 preferentially supports the proliferation and differentiation of progenitors at early stages of hematopoietic development. In addition, IL-3 exerts a wide spectrum of biological activities on various target cell populations, including T cells, B cells, eosinophils, basophils and monocytes^[2].

The ED₅₀ is <0.2 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of >5.0 × 10⁶ units/mg.

Canine

E. coli

Tag Free

Q9BDX4 (R24-P143)

481497  [NCBI]

RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPNLDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQRKLKKYLEALDNFLNFKNKP

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Mangi MH, et al. Interleukin-3 in hematology and oncology: current state of knowledge and future directions. Cytokines Cell Mol Ther. 1999 Jun;5(2):87-95.  [Content Brief]

  [2]. Morris CF, et al. Molecular and cellular biology of interleukin-3. Immunol Ser. 1990;49:177-214.  [Content Brief]