IL-3 Protein, Human (HEK293, His)

IL-3 Protein, Human (HEK293, His) is a multipotent hematopoietic growth factor that can control blood formation. IL-3 Protein, Human (HEK293, His) is a recombinant human interleukin-3 (rhIL-3) expressed in HEK 293 cells with a His tag. rhIL-3 is also a weak inflammatory mediator. rhIL-3 can be used to improve states of hematopoietic failure^[1].

IL-3 has growth- and differentiation inducing potential on cells of the erythroid, granulocyte-macrophage (GM), megacaryocyte, and mast-cell lineage in vitro.
In addition IL-3 enhances the function of mature myeloid effector cells by stimulating monocyte- and eosinophil-mediated phagocytosis and antibody-dependent cellular cytotoxicity (ADCC), monocyte M-CSF receptor expression, tumor necrosis factor (TNF) and M-CSF synthesis, and basophil production of intracellular histamine and its release in response to complement factor C5a.
Thus, IL-3 may serve as a recruitment factor for activated inflammatory cells in states of increased demand, rather than being a major regulatory element in steady-state hematopoiesis^[1].

The cell proliferation assay using TF-1 human erythroleukemic cells has an ED₅₀ value of 0.3-1.5 ng/mL.

Human

HEK293

C-6*His

P08700 (A20-F152)

3562  [NCBI]

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

17-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. A Lindemann, et al. Biologic effects of recombinant human interleukin-3 in vivo. J Clin Oncol. 1991 Dec;9(12):2120-7.  [Content Brief]