1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-31
  5. IL-31 Protein, Cynomolgus (HEK293, His)

IL-31 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P77006
SDS COA Handling Instructions

IL-31 is a multifunctional cytokine that activates STAT3 through IL-31 heterodimeric receptors (IL31RA and OSMR) and may activate STAT1 and STAT5. IL-31 is known for its involvement in skin immunity, where it regulates immune responses. IL-31 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-31 protein, expressed by HEK293 , with C-His labeled tag. The total length of IL-31 Protein, Cynomolgus (HEK293, His) is 137 a.a., with molecular weight of 19-23 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $45 In-stock
10 μg $115 In-stock
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-31 is a multifunctional cytokine that activates STAT3 through IL-31 heterodimeric receptors (IL31RA and OSMR) and may activate STAT1 and STAT5. IL-31 is known for its involvement in skin immunity, where it regulates immune responses. IL-31 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-31 protein, expressed by HEK293 , with C-His labeled tag. The total length of IL-31 Protein, Cynomolgus (HEK293, His) is 137 a.a., with molecular weight of 19-23 KDa.

Background

IL-31, a cytokine with diverse functions, acts by activating STAT3, and potentially STAT1 and STAT5, utilizing the IL-31 heterodimeric receptor formed by IL31RA and OSMR. This activation mechanism has been implicated in skin immunity, highlighting its role in modulating immune responses. Additionally, IL-31 exhibits the capacity to enhance myeloid progenitor cell survival in vitro, emphasizing its involvement in cellular processes beyond immune regulation. Furthermore, IL-31 induces the expression of key genes, such as RETNLA and serum amyloid A protein, in macrophages, suggesting a broader impact on inflammatory and immune-related pathways.

Biological Activity

Measured by its ability to induce STAT3 activation in U 87 MG human glioblastoma/astrocytoma cells. Recombinant Cynomolgus IL-31 can effectively induce STAT3 activation.

Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

EHH66805 (L27-T163)

Gene ID
Molecular Construction
N-term
IL-31 (L27-T163)
Accession # EHH66805
His
C-term
Synonyms
IL31; IL-31; Interleukin-31
AA Sequence

LPVHFLQPSDIQKIVEELQSLSKMLLKDVKEDKGVLVSQNYTLPCLTPDAQPPNIIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT

Molecular Weight

Approximately 19-23 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-31 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-31 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77006
Quantity:
MCE Japan Authorized Agent: