IL-33 Protein, Canine

IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag. The total length of IL-33 Protein, Canine is 154 a.a., with molecular weight of ~19 kDa.

IL-33 Protein is a cytokine that binds to and activates the IL1RL1/ST2 receptor, leading to the activation of NF-kappa-B and MAPK signaling pathways in target cells. It plays a role in the maturation of Th2 cells and induces the secretion of T-helper type 2-associated cytokines. IL-33 is also involved in the activation of mast cells, basophils, eosinophils, and natural killer cells. It acts as a chemoattractant for Th2 cells and may function as an 'alarmin', amplifying immune responses during tissue injury. Additionally, IL-33 induces rapid mitochondrial rewiring via UCP2, reducing the generation of reactive oxygen species and preserving the integrity of the Krebs cycle, which is essential for the production of itaconate and subsequent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelial cells, IL-33 is constitutively and abundantly expressed in its uncleaved form, acting as a chromatin-associated nuclear factor with transcriptional repressor properties and sequestering nuclear NF-kappaB/RELA, resulting in lower expression of its target genes. However, this form is rapidly lost upon angiogenic or pro-inflammatory activation.

Measured by its binding ability in a functional ELISA. Immobilized IL-33 Protein, Canine at 10 μg/mL (100 μL/well) can bind human IL1R4-Fc and the EC₅₀ is 0.25-0.66 μg/mL.

Canine

E. coli

Tag Free

O97863 (S110-S263)

403810  [NCBI]

SIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS

Approximately 19 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from sterile PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.