IL-33 Protein, Mouse

IL-33 Protein, Mouse is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation.

Interleukin-33 (IL-33) was originally described as an inducer of type 2 immune responses, activating T helper 2 cells and mast cells. Evidence shows that IL-33 also potently stimulates group 2 innate lymphoid cells, regulatory T cells, TH1 cells, CD8+ T cells and natural killer cells^[1]. IL-33 is a crucial immune modulator with pleiotropic activities in type-2, type-1 and regulatory immune responses, and important roles in allergic, fibrotic, infectious, and chronic inflammatory diseases^[2].

1. The ED₅₀ is <0.5 ng/mL as measured by murine D10S cells, corresponding to a specific activity of >2.0 × 10⁶ units/mg.
2. Measured in a cell proliferation assay using CTLL-2 cells. The ED₅₀ for this effect is 0.007306 ng/mL, corresponding to a specific activity is 1.37×10⁸ units/mg.
3.Immobilized Mouse IL-33 at 5 μg/mL (100 μl/well) can bind Mouse ST2-Fc.The ED₅₀ of Mouse ST2-Fc is 0.194 μg/mL.

• 
  Measured in a cell proliferation assay using CTLL-2 cells.The ED₅₀ for this effect is 0.007306 ng/mL, corresponding to a specific activity is 1.37×10⁸ units/mg.

Mouse

E. coli

Tag Free

Q8BVZ5 (S109-I266)

77125  [NCBI]

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

approximately 20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS, 1 mM DDT, pH 7.4 or PBS, 1 mM EDTA or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Liew FY, et al. Interleukin-33 in health and disease. Nat Rev Immunol. 2016 Nov;16(11):676-689.  [Content Brief]

  [2]. Cayrol C, et al. Interleukin-33 (IL-33): A nuclear cytokine from the IL-1 family. Immunol Rev. 2018 Jan;281(1):154-168.  [Content Brief]