IL-36 alpha/IL-1F6 Protein, Human (153a.a)

IL-36 alpha (IL-1F6), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha mediates inflammatory response. IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases^[1]. IL-36 alpha also binds to IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP^[2]. IL-36 alpha/IL-1F6 Protein, Human is a recombinant human IL-36 alpha (K6-F158) without any tag, which is produced in E. coli.

IL-36 alpha, a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha is expressed in monocytes, T/B-lymphocytes, spleen, bone-marrow tonsils, lymph nodes and skin^[2]. IL-36 alpha is up-regulated in injured kidney. IL-36 alpha is associated with the development of renal pathologies, as well as hepatocellular carcinoma, and some inflammatory/immune diseases including colitis and psoriasis^[3].
The sequence of amino acids in IL-36 alpha differs in different species. Human IL-36 alpha shares <55% aa sequence identity with mouse.
IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, thereby mediating inflammatory response. But the activation requires N-terminal cleavage by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3^[1]. IL-36 alpha can also bind IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP^[2].
IL-36 alpha is a pro-inflammatory factor. IL-36 alpha mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway^[1].

IL-36 alpha (human) (10 ng/mL, 48 h) stimulates the production of TNF-α and IL-1β in HCECs^[4].
IL-36 alpha (human) (500 ng/mL, 48 h) induces maturation of human MDDCs^[5].
IL-36 alpha (human) inhibits proliferation, migration, and invasion of both OV2008 and SKOV-3 cells^[6].

Measured by its ability to induce IL-8 secretion by A431 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 21.61 ng/mL. Corresponding to a specific activity is 4.63×10⁴ U/mg.

Human

E. coli

Tag Free

Q9UHA7 (K6-F158)

27179  [NCBI]

KIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Approximately 17.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, 0.02% Tween 20, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. Zhou L,et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210.  [Content Brief]

  [2]. Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25(6):458-65.  [Content Brief]

  [3]. Murrieta-Coxca JM, et al. IL-36 Cytokines: Regulators of Inflammatory Responses and Their Emerging Role in Immunology of Reproduction. Int J Mol Sci. 2019 Apr 3;20(7):1649.  [Content Brief]

  [4]. Li JM, et al. IL-36α/IL-36RA/IL-38 signaling mediates inflammation and barrier disruption in human corneal epithelial cells under hyperosmotic stress. Ocul Surf. 2021 Oct;22:163-171.  [Content Brief]

  [5]. Higgins J, et al. IL-36α induces maturation of Th1-inducing human MDDC and synergises with IFN-γ to induce high surface expression of CD14 and CD11c. Hum Immunol. 2015 Apr;76(4):245-53.  [Content Brief]

  [6]. Chang L, et al. IL-36α suppresses proliferation of ovarian cancer cells. Tumour Biol. 2017 Jun;39(6):1010428317706918.  [Content Brief]