IL-36RN Protein, Mouse

IL-36RN protein exhibits cytokine activity, interleukin 1 receptor antagonist activity, and interleukin 1 receptor binding activity. It negatively regulates IL-6 production and is predicted to be localized in the cytoplasm and extracellular regions. IL-36RN Protein, Mouse is the recombinant mouse-derived IL-36RN protein, expressed by E. coli , with tag free. The total length of IL-36RN Protein, Mouse is 154 a.a., with molecular weight of ~17 kDa.

IL-36RN protein is predicted to possess several important functional attributes, including cytokine activity, interleukin-1 receptor antagonist activity, and interleukin-1 receptor binding activity. It plays a role upstream of or within the negative regulation of interleukin-6 production. The protein is predicted to be located in both the cytoplasm and extracellular region, suggesting its potential involvement in diverse cellular processes. Furthermore, IL-36RN is anticipated to be active in the extracellular space. In humans, this gene is associated with pustular psoriasis 14, indicating its relevance in skin pathology. Notably, IL-36RN shares orthology with the human interleukin 36 receptor antagonist (IL36RN). Expression analysis reveals biased expression in the adult stomach (RPKM 9.0) and lung (RPKM 1.0), underscoring its potential significance in these tissues.

Measured by its ability to inhibit IL-36 beta induced IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 0.8070 μg/mL, corresponding to a specific activity is 1239.1574 U/mg, in the presence of 15 ng/mL of Recombinant Mouse IL-36 beta.

• 
  Measured by its ability to inhibit IL-36 beta induced IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED₅₀for this effect is 0.8070 μg/mL, corresponding to a specific activity is 1239.1574 U/mg, in the presence of 15ng/mL of Recombinant Mouse IL-36 beta.

Mouse

E. coli

Tag Free

NP_062324.2 (V3-D156)

54450  [NCBI]

VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Approximately 19-24 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.